SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_008412270.1.1237 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_008412270.1.1237
Domain Number 1 Region: 29-513
Classification Level Classification E-value
Superfamily Sema domain 3.66e-100
Family Sema domain 0.0011
Further Details:      
 
Domain Number 2 Region: 1380-1505,1671-1855
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 5.1e-35
Family p120GAP domain-like 0.02
Further Details:      
 
Domain Number 3 Region: 854-946
Classification Level Classification E-value
Superfamily E set domains 0.000000000000153
Family Other IPT/TIG domains 0.011
Further Details:      
 
Domain Number 4 Region: 944-1036
Classification Level Classification E-value
Superfamily E set domains 0.00000000000117
Family Other IPT/TIG domains 0.035
Further Details:      
 
Domain Number 5 Region: 1037-1116
Classification Level Classification E-value
Superfamily E set domains 0.00000000000509
Family E-set domains of sugar-utilizing enzymes 0.026
Further Details:      
 
Domain Number 6 Region: 516-568
Classification Level Classification E-value
Superfamily Plexin repeat 0.0000000000436
Family Plexin repeat 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_008412270.1.1237
Sequence length 1895
Comment PREDICTED: plexin-D1 isoform X4 [Poecilia reticulata]; AA=GCF_000633615.1; RF=representative genome; TAX=8081; STAX=8081; NAME=Poecilia reticulata; strain=Guanapo; AL=Chromosome; RT=Major
Sequence
MPPSMEIAVLLLGVLALETRRSASALHIQQAFASPNLTNNFVVDPVSRRVYLATVNTVYQ
LNGTLTVEVEKRTGPVEDNLLCHAPQLPQAPCEHPKSLTDNYNKLLKLDREQGVVVMCGS
VYQGFCELRRMGNISEIAVEFPPQGEKTVFPSMLNIAANHPNASTVGLIFKSHGGNTRLL
VGATYTGAGTQFFPKNHSKEDLRFENTPEIAIRSLNVKDLSRLFTYDINPSEDNVFKIKQ
EVKTKNKLNFVHAFIQKTYSYIVFNNDAKMGHKENQPNSILARICLDSDIPRKSTGSESK
KLTESYIQMPLQCGPNGNIYNRLLSVYPAEVHGGSGGGPEPYLFGVFSKADRNSALCAFK
FGDIEAEIRQGRSNCSNSPSSDVQVLDSVIQGSGAVCIQKGNIVLQPEQLDCGAAHLQHP
LALRRPLRAIPLFGNSALSSVSVDNVHNHTVVFLGTSNGRLHKLTLFPNMTLASQRNMKL
PAGEAVHHIMTFDPNDGNFLYVMTSHHMLRVKVAECDQWKTCTDCLGAKDAYCGWCTLEN
RCTIQNECARGLLPRSWITLGEGPKQCPSITLTPPEISISAKIEAVGILINGSIPDLIGS
KVECEYKPGVSTAATVYGLQIQTCPLLPPENYQPIPPGTDHLTVLVAIKVNGTSVVSGSF
IIYDCERTGQIHPKTSCMSCLSTRWKCYWDQEHHQCLSSKDESKPNLLESVASCPSLIPS
EVPPSPSGMAQDFTMNLSNIQGTEKLECDFGIGRRYEAIWLDNSTVKCSGVTLFTNQRSQ
IYHLSLRRAGYFSSQREDIFLDSPQPMKVEVYNCGAGSSDCSQCWGREDQGHLCGWCESS
CRPRDDCQPDRNVCPAPEIHKISPLRGPVEGGTLLTVQGRNLGRRPAGVNIFIGDVPCDL
LPERYTVSVEFVCRTGRSLHDRTDSVRVDVDQSGTGTSKESFAYLEPNVESIYPEKGSRA
GGTRVTIRGEHLDIGSQVRVKVNRTQECTITVKTDQTIKCIMPPALEADAELVTVCVEFE
DHPCEEANLSTMYTYEQNPTISFIHPTKSFLSGGRTITVKGHGFDLVQSVTMNVLEIGQT
NCSVLSSSTITCLSPESSQSQETSVQFVLNGIPYTGDSPSSADDRPEEEDGEPHKEHFQL
GYVEDPQFFTTNKDKQIKHHSGEPLTLIINKVPSELELVPDEYLVMIGSYPCNISFHNDQ
LFHCTINGQLSSSESELPVTVQVGNFRHMITKVQLGGSELAIVVSIVVCCVLLLLCTVAL
VVYCTKSRRAERYWQKTLLQMEEMESQIREEIRKGFAELQTDMTDLTKELNRSQGIPFLE
YKQFVTRTFFPKMCSDYENSLVQPTYVNDSLGPRALPETHPLLQDWQANNTTRPNVEEGI
TLFSTLLNNKHFLITFVHALEQQKDFAVRDRCSLASLLTIALHGKLEYYTSIMKDLLVDL
IDASASKNPKLMLRRTESVVEKMLTNWMSICMYSFLKETVGEPFFLILCAIKQQINKGSI
DALTGKARYTLNEEWLLRENIEAKPQNINVSFQGCGMDSLSVRVMNTDTICQVKEKIIEA
FYKNLPFSQWPRAEDVDLEWFDSGSNSKLLQDLDNSSVMEDGRKKLNTVFHYQIPEGASL
AMSMKDKKENTLERVKDLDTEKYVHLVLPHDELIETKKSHRHNHRKKVLPEIYLTRLLST
KGTLQKFLDDLLKAILSIPPDRPPLAVKYFFDFLEEQADKRGITDPDTLHIWKTNSLPLR
FWVNILKNPQFVFDIDKTDHMDACLSVIAQVFIDACSISDLQLGKDSPTNKLLYAKEIPE
YKKWVQCYYKQIQEMPPLSEQEMNAHLAEESRKYRNEFNTNLALTEIYKYAKRYRNQVVN
ALEANPTARRTQLHHKFEQVIALVEDNIYECCSEA
Download sequence
Identical sequences XP_008412270.1.1237

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]