SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_008433388.1.1237 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_008433388.1.1237
Domain Number 1 Region: 101-162
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000131
Family Complement control module/SCR domain 0.0024
Further Details:      
 
Domain Number 2 Region: 247-305
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000486
Family Complement control module/SCR domain 0.0028
Further Details:      
 
Domain Number 3 Region: 64-115
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000417
Family Complement control module/SCR domain 0.0062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_008433388.1.1237
Sequence length 365
Comment PREDICTED: sushi repeat-containing protein SRPX, partial [Poecilia reticulata]; AA=GCF_000633615.1; RF=representative genome; TAX=8081; STAX=8081; NAME=Poecilia reticulata; strain=Guanapo; AL=Chromosome; RT=Major
Sequence
MELWPLALLLVQFCLCSGYEGSGHYGYGDDEDWYSRRYKGTPWCAPIKLKHGDSSCRTPR
GEHYRNVMGTRCKIRCKRGYESQNTEVVCMASKHWSSNYACREIRCPKLNMLANGGYKCS
DGSYYNSRCEFFCSAGYSMKGQKTSVCQYNKVWSAGVPTCIDIDPPKIKCPNVKDKWAEP
GKLTARVTWDTPEGVDTADGILTDVTLKGKPPKSDFPEGLHKMSYSVFDRAGNKGSCRFT
IRVRVRRCSPLFPPDNGYMKCDSDGDNYGATCHFSCTGGFELQGSAARVCQSGLSWSGLD
TTCAPMNINVGVRSAAALLDQFYEKRRLLIISAPTAANHNYRFQMTNLQVRHDSGVHTHS
HTRTH
Download sequence
Identical sequences XP_008433388.1.1237

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]