SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_008506494.1.77740 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_008506494.1.77740
Domain Number 1 Region: 23-351
Classification Level Classification E-value
Superfamily Calcium-dependent phosphotriesterase 2.03e-43
Family Serum paraoxonase/arylesterase 1, PON1 0.0000000000817
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_008506494.1.77740
Sequence length 355
Comment PREDICTED: serum paraoxonase/arylesterase 1 [Equus przewalskii]; AA=GCF_000696695.1; RF=representative genome; TAX=9798; STAX=9798; NAME=Equus przewalskii; AL=Scaffold; RT=Major
Sequence
MGKMTVLSLLGLGLAFFRDPWSSYQTRFNVFREVEPVELPNCNFVKGIEAGSEDLEILSN
GLVFVSSGLKYPGLKSFEHDKPGKILLMNLNEEEPTVLELRIIGSKFDLSSFNPHGISTF
TDEDNTVYLLVVNHPDFKSTVELFKFQEEEKSLLHLKTIRHKLLPNMNDIVAVGPEHFYA
TNDHYFLDPFLKSWELYLGLAWSNVVYYSPNEVQMVADGYDFANGINISPDGKYVYVAEL
MAHKIHVYEKHANWTLTPLKHLDFNTLVDNISVDPVTGDLWVGCHPNGKKIFFYDPKNPP
PSEVLRIQDILSEEPKVTVVYAENGTVLQGSTVASVYKGKLLIGTVFHKALYCEL
Download sequence
Identical sequences F7DTV1
ENSECAP00000000234 9796.ENSECAP00000000234 XP_001493453.3.31192 XP_008506494.1.77740 ENSECAP00000000234

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]