SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_008507653.1.77740 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_008507653.1.77740
Domain Number 1 Region: 30-143
Classification Level Classification E-value
Superfamily E set domains 7.28e-33
Family SVA-like 0.0000182
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_008507653.1.77740
Sequence length 146
Comment PREDICTED: prolactin-inducible protein [Equus przewalskii]; AA=GCF_000696695.1; RF=representative genome; TAX=9798; STAX=9798; NAME=Equus przewalskii; AL=Scaffold; RT=Major
Sequence
MRSFQLLFRASPAALILVLCLQLGINKAQEYTRRAIIMDLQTPQTTTADEEVTVKLRVET
ELRECMVIKSYLLSDVPIDGAFNYKFTSCLCENYPRTFFWDFQTNSTVRIAAVVDVIREQ
NICPEDLAVIPMTANRFHILRTLNKV
Download sequence
Identical sequences F6V6R7
XP_008507653.1.77740 XP_014594740.1.31192 ENSECAP00000020186 ENSECAP00000020186 9796.ENSECAP00000020186

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]