SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_008512664.1.77740 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_008512664.1.77740
Domain Number 1 Region: 53-162
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 5.36e-22
Family Spermadhesin, CUB domain 0.00087
Further Details:      
 
Domain Number 2 Region: 236-338
Classification Level Classification E-value
Superfamily Cystine-knot cytokines 3.68e-20
Family Platelet-derived growth factor-like 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_008512664.1.77740
Sequence length 345
Comment PREDICTED: platelet-derived growth factor C isoform X1 [Equus przewalskii]; AA=GCF_000696695.1; RF=representative genome; TAX=9798; STAX=9798; NAME=Equus przewalskii; AL=Scaffold; RT=Major
Sequence
MLLFGLLLLTSALAGQRHGTQAESNLSSKFQFSSNKEQNGVQDPQHERIITVSTNGSIHS
PRFPHTYPRNMDLVWRLVAVEENVWIQLTFDERFGLEDPEDDICKYDFVEVEEPSDGTIL
GRWCGSGTVPGKQISKGNQIRIRFVSDEYFPSEPGFCIHYNIVMPQFTEAVSPSALPPSA
LPLDLLNNAVTAFSTLEDLIRYLEPDRWQLDLEDLYRPTWQLLGKAFVFGRKSRVVDLNL
LKEEVRLYSCTPRNFSVSIREELKRTDTIFWPGCLLVKRCGGNCACCLHNCNECQCVPSK
VTKKYHEVLQLRPKNGVRGLHKSLTDVALEHHEECDCVCRGNSGG
Download sequence
Identical sequences F7DYB8
ENSECAP00000017076 ENSECAP00000017076 9796.ENSECAP00000017076 XP_001500695.1.31192 XP_008512664.1.77740 XP_014699555.1.49734

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]