SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_008520347.1.77740 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_008520347.1.77740
Domain Number 1 Region: 224-438
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.86e-31
Family Clostridium neurotoxins, the second last domain 0.071
Further Details:      
 
Domain Number 2 Region: 687-767,797-813
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 0.0000000000176
Family Reprolysin-like 0.082
Further Details:      
 
Domain Number 3 Region: 1522-1596
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000101
Family Complement control module/SCR domain 0.0022
Further Details:      
 
Domain Number 4 Region: 538-616,719-755
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 0.00001
Family Zinc protease 0.079
Further Details:      
 
Domain Number 5 Region: 1588-1645
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000181
Family Complement control module/SCR domain 0.0065
Further Details:      
 
Domain Number 6 Region: 1467-1528
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000306
Family Complement control module/SCR domain 0.0064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_008520347.1.77740
Sequence length 1790
Comment PREDICTED: pappalysin-2 [Equus przewalskii]; AA=GCF_000696695.1; RF=representative genome; TAX=9798; STAX=9798; NAME=Equus przewalskii; AL=Scaffold; RT=Major
Sequence
MMCLRILRISLVILAAWALGTASSEPGWTRKRSLVQRGHLNQVLSEGERCWLGAKVRRLR
AAPQHHLFGVYPSRPGNYLRPYALGDQGNHHAGQSKPAADGVAVSHVPPDPSGSAGVRSE
AEQPAAPQAGDGPIGQSELRGHDDTYLGDPASKESLGEADIQEGSVMAATITTTFARPKE
REPGTQRKGLAKTRCRRQAVKGQAEGRQGDPDVSPWRFQRWPQHAFVHGDRNSPLEDSIQ
DGGGDPYGEAETFNPDRGLPVLYFSGRRERLLLRPEVLAEIPREEFTVEVWVKPEGGQNN
PAIIAGVFDNCSHTVSDKGWALGIRSGKDMRRRDARFFFSLRTDRMKKATIVIGHSRYQP
GTWTHVAATYNGQRMALYVDGTQVASSSDQSGPMNSPFMASCRSLILGGDSSENGHYFRG
HLGTLVVWSAALPQSHLQHSPQYPSRVEELTTLILTASFEPLEEQWAPFRDGNYPRLEVL
QGFESEPEILSPLQPPLCGQTACDNVELISQYNGHWPLRGEKVIRYQVVNICDDKGLNPT
VSEEQIRRQHEALNEAFSRYNISWQLSVHQVHNSTLRHRVVLVNCEPSKIGNDHCDPECE
HPLTGYDGGDCRLHGRCYSWNRRDGLCHVECNNMLNDFDDGDCCDPEVADVRKTCFDPDS
PKRAYMSVKELKEALQLNSTHFLNVYFASSVREDLAGAATWPWDKEAVSHLGGVVLNPSY
YGMSGHTNIMIHEVGHVLGLYHVFKGVSERESCDDPCRETVPSMDTGDLCADTAPTPKSK
LCRDPEPTNDTCGFTHFPGAPFSNYMSYTDDDCTDNFTPNQVARMHCYLDLVYQQWSQSQ
KPTPIPIPPMVIGQTHKSLTIHWLPPISGVVYDRAPGSVCGACTEDGTFRQYVYTASSRR
VCDSSGYWTPEEAVGPPDVDQPCEPSLQAWSPELHLYHMNMTVPCPSEGCSLELLFQHPV
QADTLTLWVTYLSMDSSQALFDTEILVEHQESVHLGPLDTFCDTPLTIKLHVDGKVLGVK
VYTFDERMEIDAALLTSQPHSPLCSGCRPVSYQVLREPPFASGLPMVVTDPHRKFTDVEV
TPGQMYRYQVQAEAGAELGEASPPLSHIHGAPYCGDGKVARSLGEECDDGDLLSGDGCSR
ACELEEGFNCEGEPSLCYIFEGDGICEPFEKETSIIDCGLYTPKGYLDQWAAQAYSSRED
KKCPVSLVTGEPHSMICASYHPDLLEHRPLTGWFPCATRGNRPQDERSEQPEGSLERENE
VWLKVCFSRPGVATAIFLFLTSDGLVPGEHQRPTVTLHLTDVSGNNHSLGTYELSCQHNP
LVINVTHHPNVLFHHTTSVLLNFSSSLVGISAVALRTSSHISPSATNNCIPEHEGPNHQA
QSCVHRPCGEQGSCVPLLLDHADVVNCTSGGPGHMKCAITCQRGFALQASSGQYLRPMQK
EILLTCSSGHWDRAVSCMPIDCGVPDPSLVSYATFSCSKGTDFLKRCSITCVPPAKLQGL
SPWLTCLEDGLWSLPEAYCKLECDAPPDIRNAKLLLPHCLQGNHDVGSVCRYECKPGYYV
VEGVESKVRNKFLKIQCLEGGIWEQGSCVPVVCEPPSPVFEGMYECTNGFELDSQCVLKC
NQESERLPILCTKEGLWTEEFKLCENLQQGECPPPPSELNLVEYKCEQGYGIGAVCSPLC
VIPPSDPVILPENITADTLEHWMEPVKVQSIMCTGQRQWHPDPFLVHCIQACEPFQADGW
CDTINNRAYCHYDGGDCCSSTLSSKKVIPFAADCDLDECTCRDPKAEENQ
Download sequence
Identical sequences XP_008520347.1.77740

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]