SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_008523161.1.77740 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_008523161.1.77740
Domain Number 1 Region: 199-343
Classification Level Classification E-value
Superfamily PH domain-like 2.34e-45
Family Third domain of FERM 0.00000026
Further Details:      
 
Domain Number 2 Region: 89-198
Classification Level Classification E-value
Superfamily Second domain of FERM 3.93e-38
Family Second domain of FERM 0.000000725
Further Details:      
 
Domain Number 3 Region: 499-586
Classification Level Classification E-value
Superfamily Moesin tail domain 2.22e-32
Family Moesin tail domain 0.0000245
Further Details:      
 
Domain Number 4 Region: 2-87
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.51e-26
Family First domain of FERM 0.000007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_008523161.1.77740
Sequence length 586
Comment PREDICTED: ezrin [Equus przewalskii]; AA=GCF_000696695.1; RF=representative genome; TAX=9798; STAX=9798; NAME=Equus przewalskii; AL=Scaffold; RT=Major
Sequence
MPKPINVRVTTMDAELEFAIQPNTTGKQLFDQVVKTIGLREVWYFGLQYVDNKGFPTWLK
LDKKVSAQEVRKENPLQFKFRAKFYPEDVSEELIQDITQKLFFLQVKDGILSDEIYCPPE
TAVLLGSYAVQAKFGDYNKETHKSGYLGSERLIPQRVMDQHKLTRDQWEDRIQVWHAEHR
GMLKDNAMLEYLKIAQDLEMYGINYFEIKNKKGTDLWLGVDALGLNIYEKDDKLTPKIGF
PWSEIRNISFNDKKFVIKPIDKKAPDFVFYAPRLRINKRILQLCMGNHELYMRRRKPDTI
EVQQMKAQAREEKHQKQLERQQLETEKKRRETVEREKEQMLREKEELMLRLQDYEEKTKK
AEKELSDQIQRALQLEEERKRAQEEAERLEADRVAALRAKEELERQAVDQMKSQEQLAAE
LAEYTAKIALLEEARRRKESEVEEWQHRAKEAQDDLVKTKEELHLVMTAPPPPPPPVYEP
VSYHVRENPQEEGTEYLGYSAELSSEGILGDRNEEKRITEAEKNERVQRQLMTLTSELSQ
ARDENKRTHNDIIHNENMRQGRDKYKTLRQIRQGNTKQRIDEFEAL
Download sequence
Identical sequences F7BPT4
XP_001492102.4.31192 XP_008523161.1.77740 XP_014713826.1.49734 9796.ENSECAP00000016264 ENSECAP00000016264 ENSECAP00000016264

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]