SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_008525227.1.77740 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_008525227.1.77740
Domain Number 1 Region: 464-683
Classification Level Classification E-value
Superfamily Bet v1-like 3.85e-40
Family STAR domain 0.0054
Further Details:      
 
Domain Number 2 Region: 137-185
Classification Level Classification E-value
Superfamily PH domain-like 0.00000373
Family Pleckstrin-homology domain (PH domain) 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_008525227.1.77740
Sequence length 692
Comment PREDICTED: collagen type IV alpha-3-binding protein [Equus przewalskii]; AA=GCF_000696695.1; RF=representative genome; TAX=9798; STAX=9798; NAME=Equus przewalskii; AL=Scaffold; RT=Major
Sequence
MADKICRFADRVLMGYEKSEELDDFRSKQLVVTIDRNVEAYQRGSWGAAHIVSFGYVEMP
FRRSREDIEQAVKFVMYLTSPSPGISRVSEEPWLLWVENSSRVLCGSQGLDHLTVGVSFC
YAASPQVVDGCNGCLVSIFCQLYLWEQPHDFDECRFDISVNDSIWYLRAEDPAHRQLWID
AIEQHKTESGYGSESSLRRHGSMVSLVSGASGYSATSTSSFKKGHSLREKLAEMETFRDI
LCRQVDTLQKYFDACADAVSKDELQRDKVVEDDEDDFPTTRSDGDFLHNTNGNKEKIFPH
VTPKGINGIDFKGEAITFKATTAGILATLSHCIELMVKREDSWQKRLDKEIEKRRRIEEA
YKNAVTELKKKSHFGGPDYEEGPNSLINEEEFFDAVEAALDRQDKIEEQSEKVRLHWPTS
MPSGDAFSSVGTHRFVQKPYSRSSSMSSIDLVSASDDVHRFSSQVEEMVQNHMTYSLQDV
GGDANWQLVVEEGEMKVYRREVEENGIVLDPLKATHAVKGVTGHEVCNYFWNVDVRNDWE
TTIENFHVVETLADNAIIIYQTHKRVWPASQRDVLYLSAIRKIPALTENDPETWIVCNFS
VDHDSAPLNNRCVRAKINVAMICQTLVSPPEGDQEISRDNILCKITYVANVNPGGWAPAS
VLRAVAKREYPKFLKRFTSYVQEKTAGKPILF
Download sequence
Identical sequences XP_008525227.1.77740

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]