SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_008530378.1.77740 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_008530378.1.77740
Domain Number 1 Region: 285-381
Classification Level Classification E-value
Superfamily Immunoglobulin 2.36e-20
Family I set domains 0.013
Further Details:      
 
Domain Number 2 Region: 402-732
Classification Level Classification E-value
Superfamily 3-carboxy-cis,cis-mucoante lactonizing enzyme 2.35e-16
Family 3-carboxy-cis,cis-mucoante lactonizing enzyme 0.033
Further Details:      
 
Domain Number 3 Region: 16-84
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.00000000000000873
Family Ovomucoid domain III-like 0.01
Further Details:      
 
Domain Number 4 Region: 208-298
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000119
Family I set domains 0.029
Further Details:      
 
Domain Number 5 Region: 130-203
Classification Level Classification E-value
Superfamily EF-hand 0.00000000412
Family Calmodulin-like 0.076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_008530378.1.77740
Sequence length 793
Comment PREDICTED: follistatin-related protein 4 [Equus przewalskii]; AA=GCF_000696695.1; RF=representative genome; TAX=9798; STAX=9798; NAME=Equus przewalskii; AL=Scaffold; RT=Major
Sequence
MRREGLSGHSGLPTSCGKKFCSHGSRCVLSRETGEPECRCLEACRPSYMPVCGSDGRFYE
NHCELHRAACLLEKKIVIVHSKDCFLKGDPCTMADYARLKNVLLAIQTRLQPPQEGDSRQ
DPASQKRLLVESLFKDLDADGDGHLSSNELAQHVLKEQDLEEDFLGCSPGDLLRFDDYNK
DGSLTLHEFYTAFQVVQLSLTPEERVSVATVTVGLSTVLTCAIRGDLRPPIIWKRNGLAL
NFLDLEDINDFGEDDSLYITKVTTIHMGNYTCHASGHEELFQTHVLQVNVPPVIRVYPET
QAQEPGVAASLRCHAEGIPMPRITWLKNGVDVSTQMSKQLSLLANGSELHISSVRYEDTG
AYTCIAKNEVGVDEDISSLFIEDSARKTLANILWREEGLSVGNMFYVFSDDGIIILHPVD
CEIQRHLKPTEKIFMSYEEICPQGEGDATQPCQWASAVNVRHRYIYVAQPALSRVLVVDV
QAQKVLQSIGVDPLPAKLSYDKSHDQVWVLSWGDVHKSQPSLQVITEASTGQGQHLIRTP
FTGVDDFFIPPTNLIINHIRFGFIFNKSEPVVHKVDLERLMLLKTIGLQRHGCMPQAMAH
THLGGYFFIQCRQDGSTSAAPQLLIDSVTDSVVGPNGDVSGTPHTSPDGRFIVSAAATSP
KLHVQEITLRGEIQTLYDLTISQGISDVAFQRSFTQGNQYYVYATLETEPALLFLELSTG
KTGVLKNLKEPPRGPAWPWGGPRRIMRDSGLFGQYLLTPAQESLFLINGRQNTLRCEVSG
IKRGTMVVWVGEV
Download sequence
Identical sequences XP_008530378.1.77740

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]