SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_008531337.1.77740 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_008531337.1.77740
Domain Number 1 Region: 87-531
Classification Level Classification E-value
Superfamily Sema domain 6.54e-115
Family Sema domain 0.00012
Further Details:      
 
Domain Number 2 Region: 1379-1517,1694-1874
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 9.81e-40
Family p120GAP domain-like 0.021
Further Details:      
 
Domain Number 3 Region: 866-960
Classification Level Classification E-value
Superfamily E set domains 1.78e-17
Family Other IPT/TIG domains 0.0056
Further Details:      
 
Domain Number 4 Region: 958-1048
Classification Level Classification E-value
Superfamily E set domains 0.000000000000178
Family Other IPT/TIG domains 0.04
Further Details:      
 
Domain Number 5 Region: 534-583
Classification Level Classification E-value
Superfamily Plexin repeat 0.0000000000296
Family Plexin repeat 0.0021
Further Details:      
 
Domain Number 6 Region: 1046-1158
Classification Level Classification E-value
Superfamily E set domains 0.0000496
Family E-set domains of sugar-utilizing enzymes 0.086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_008531337.1.77740
Sequence length 1907
Comment PREDICTED: plexin-B2 [Equus przewalskii]; AA=GCF_000696695.1; RF=representative genome; TAX=9798; STAX=9798; NAME=Equus przewalskii; AL=Scaffold; RT=Major
Sequence
MDPCTPTQPTTDSGVSPLRGFSWAPASCAPTSEAQLAGHSCSFGFRRVSCQSAPCADSQG
TGAMALPLWALALLGLVGTSAGLRPRKLEFFRSETELNHLVVDEASGVVYLGAVNALYQL
SAELQLEQQVATGPALDNKKCTPPIEASQCHEAMLTDNVNQLLLLDPPRKRLVECGSLFK
GICALRALSNISTCLFYEDGSGEKSFVASNDESVATVGLVSATGPGGERVLFVGKGNGPH
DNGIIVSTRLLDRAEGREAFEAYTDHATYKAGYLSTNTQQFVAAFEDGLYVFFVFNQQDK
HPPRNRTLLARMCKQDPFYYSYLEMDLQCLDPSDVQAPAFGTCLAASVAVPGAARVLYAV
FSKDGRGGGGPRAGLCLFPLDEVHAKMEANRNACYTGTRDAGRDTFYKPFHGDIQCGGHG
QGASESFPCGSEHLPYPLGSRDGLTAMAVLQRGGLNLTAVTVTAENGHTVAFLGTSDGRV
LKVYLTPDGSPAEYGSILVEINKRIKQDLVLSADLSSLYAMTQDKVFRLPVQECLSHLNC
AQCRSSQDPYCGWCVVEGRCTRRAECPRANESGHWLWSRDESCVAITGAQPQNMSRRAQG
EVQLTVSPLPALREEDELLCLFGESPPHSARVEGDAVICNSPSNIPSTPPGQDHVAVNVQ
LLFRHGNIFLTSHLYPFYDCREAMSLVENLPCISCASNRWTCQWELRYHECREASPNPED
GIVRAHMEDNCPQFLNPSPLVIPMNHETDVTFQGKNLDTVKGSSLHVGSDLLKFEEPVSV
QGPGTFFFRTPKLSHDANETLPLHLYVKSYGKNIDSKLQVTLYNCSFGRSDCSLCLAADP
TYQCVWCSGQGRCVYKALCSNATSECPPPVITRIQPETGPLGGGIRVTIHGSNLGVRADD
VKRVTVADRNCTFEPERYSVSTRIVCAIEAAEAPSTGGVMVEVNGKFGYSPPHVQFTYQQ
PQPLSVEPKQGPQAGGTTLTISGTHLDTGSEEDVRVTLSDVPCKVTQFGAQLQCVTGPQV
SLGELHLEIYYGGSLVPSPGVTFTYRENPVLRAFEPLRSFVSGGRSINVTGQGFSLIQRF
AMVVIAEPLQSWRRRREAGPLQPTMVVGTEYTFYNDSKVVFLSPAVPEEPEAYNLTALIQ
MDGHRVLLRTEAGAFEYVADPTFENFTGGVKKQVNKLIHARGTNLNKAMTLHEAEAFVGA
ERCIMKTLTETDLYCEPPEVQPPPKRRQKRDTTNNLPEFIVKFGSREWVLGRVEYDTRVS
DVPLSLILPLVIVPMVAVIAVSVYCYWRKSQQAEREYEKIKSQLEGLEESVRDRCKKEFT
DLMIEMEDQTNDVHEAGIPVLDYKTYTDRVFFLPSKDGDKDVMITGKLDIPESRRPVVEQ
ALYQFSNLLNSKSFLINFIHTLENQREFSARAKVYFASLLTVALHGKLEYYTDIMRTLFL
ELMEQYVVAKNPKLMLRRSETVVERMLSNWMSICLYQYLKVGSTWPSQVLGRGEPLYKLF
KAIKHQVEKGPVDAVQKKAKYTLNDTGLLGDDVEYAPLTVSVIVQDEGVDAVPVKVLNCD
TISQVKEKIIDQVYRTQPCSRWPKADSVVLEWRPGSTAQILSDLDLTSQREGRWKRINTL
MHYNVRDGATLLLSKVGVSQQPEDSQQDLPGERHALLEEENRVWHLVRPTDEVDEGKSKR
GSVKEKERTKAITEIYLTRLLSVKGTLQQFVDNFFQSVLAPGKAVPPAVKYFFDFLDEQA
EKHDIRDEDTVHIWKTNSLPLRFWVNILKNPHFIFDVHVHEVVDASLSVIAQTFMDACTR
TEHKLSRDSPSNKLLYAKEISTYKKMVEEQMVQVSDKDMNTHLAEISRAHTDSLNTLVAL
HQLYQYTQKYYDEIINALEDDPAAQKMQLAFRLQQIAAALENKVTDL
Download sequence
Identical sequences XP_008531337.1.77740

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]