SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_008535546.1.77740 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_008535546.1.77740
Domain Number 1 Region: 36-499
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 2.05e-113
Family L-arabinose binding protein-like 0.00000000566
Further Details:      
 
Weak hits

Sequence:  XP_008535546.1.77740
Domain Number - Region: 506-549
Classification Level Classification E-value
Superfamily TNF receptor-like 0.00424
Family TNF receptor-like 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_008535546.1.77740
Sequence length 879
Comment PREDICTED: metabotropic glutamate receptor 3 [Equus przewalskii]; AA=GCF_000696695.1; RF=representative genome; TAX=9798; STAX=9798; NAME=Equus przewalskii; AL=Scaffold; RT=Major
Sequence
MKMLTRLQVLTLALFSKGFLLSLADHNFLRREIKIEGDLVLGGLFPINEKGTGTEECGRI
NEDRGIQRLEAMLFAIDEINKDNYLLPGVKLGVHILDTCSRDTYALEQSLEFVRASLTKV
DEAEYMCPDGSYAIQENIPLLIAGVIGGSYSSVSIQVANLLRLFQIPQISYASTSAKLSD
KSRYDYFARTVPPDFYQAKAMAEILRFFNWTYVSTVASEGDYGETGIEAFEQEARQRNIC
IATAEKVGRSNIRKSYDSVIRELLQKPNARVVVLFMRSDDSRELIAAASRANASFTWVAS
DGWGAQESIIKGSEHVAYGAITLELASQPVRQFDRYFQSLNPYNNHRNPWFQDFWEQKFQ
CSLQNKRNHRRACDKHLAIDSNNYEQESKIMFVVNAVYAMAHALHKMQRTLCPNTTKLCD
AMKIVDGKKLYRDYLLKINFTAPFIPNKGADSIVKFDTFGDGMGRYNVFNFQYVGGKYSY
LKVGHWAETLSLDVDSIHWSRNSIPTSQCSDPCAPNEMKNMQPGDVCCWICIPCEPYEYL
ADEFTCMDCGLGQWPTADLSGCFDLPEDYIKWEDAWAIGPVTIACLGFLCTCMVVTVFIK
HNNTPLVKASGRELCYILLFGVGLSYCMTFFFIAKPSPVICTLRRLGLGTSFAVCYSALL
TKTNCIARIFDGVKNGAQRPKFISPSSQVFICLGLILVQIVVVSVWLILEVPGTRRYTLP
EKRETVILKCNVKDSSMLISLTYDVILVILCTVYAFKTRKCPENFNEAKFIGFTMYTTCI
IWLAFLPIFYVTSSDYRVQTTTMCISVSLSGFVVLGCLFAPKVHIILFQPQKNVVTHRLH
LNRFSVSGTGTTYSQSSASTYVPTVCNGREVLDSTTSSL
Download sequence
Identical sequences F6T9I4
9796.ENSECAP00000006741 ENSECAP00000006741 XP_008535546.1.77740 XP_014594685.1.31192 XP_014708859.1.49734 ENSECAP00000006741

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]