SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_008550434.1.5247 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_008550434.1.5247
Domain Number 1 Region: 118-195
Classification Level Classification E-value
Superfamily Chemosensory protein Csp2 0.0000000000955
Family Chemosensory protein Csp2 0.0041
Further Details:      
 
Domain Number 2 Region: 32-102
Classification Level Classification E-value
Superfamily Chemosensory protein Csp2 0.00000000667
Family Chemosensory protein Csp2 0.0055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_008550434.1.5247
Sequence length 197
Comment PREDICTED: uncharacterized protein LOC103573225 [Microplitis demolitor]; AA=GCF_000572035.2; RF=representative genome; TAX=69319; STAX=69319; NAME=Microplitis demolitor; strain=Queensland-Clemson subculture; AL=Scaffold; RT=Major
Sequence
MEACKIIFLCALGAVALISTSSAQHQISQDDYNSLKAQIDCVLDRGVCDEVGMFAKQILP
ELMLTHKCSMCDDAMNAKLQRTLGLMHVYFSNELIEIQNKYSNPRARNSEISQDKLDALK
AQIDCVLDRGVCNEMGEFAKQILPEYLRTGVCSLCNDEMNALVKNTMQLMHVYFRNELAE
IFKKYSSQPLSRHSYHH
Download sequence
Identical sequences XP_008550434.1.5247

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]