SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_008572303.1.73410 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_008572303.1.73410
Domain Number 1 Region: 101-552
Classification Level Classification E-value
Superfamily Sema domain 1.7e-115
Family Sema domain 0.0002
Further Details:      
 
Domain Number 2 Region: 1674-1801,1989-2175
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 7.46e-47
Family p120GAP domain-like 0.013
Further Details:      
 
Domain Number 3 Region: 1232-1324
Classification Level Classification E-value
Superfamily E set domains 4.46e-16
Family Other IPT/TIG domains 0.037
Further Details:      
 
Domain Number 4 Region: 1140-1235
Classification Level Classification E-value
Superfamily E set domains 0.00000000000014
Family Other IPT/TIG domains 0.0087
Further Details:      
 
Domain Number 5 Region: 555-606
Classification Level Classification E-value
Superfamily Plexin repeat 0.00000000000366
Family Plexin repeat 0.0024
Further Details:      
 
Domain Number 6 Region: 1322-1366,1396-1449
Classification Level Classification E-value
Superfamily E set domains 0.000000000108
Family Other IPT/TIG domains 0.077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_008572303.1.73410
Sequence length 2208
Comment PREDICTED: plexin-B1 [Galeopterus variegatus]; AA=GCF_000696425.1; RF=representative genome; TAX=482537; STAX=482537; NAME=Galeopterus variegatus; AL=Scaffold; RT=Major
Sequence
MCLVAEGQAGPSSTGRLGSGEGYFCVASMVGSPGLPHAWDILPQLHALLSLWLGDSHTGH
AVVSRFSRPCQVTMPALGPALLQALWAGWVLTLQPPPPAAFTPNGTYLQHLARDPTSGTL
YLGATNFLFQLSPGLQLEAMVSTGPVLDSRDCLPPVMPDECPQAQPTNNPNQLLLVSPGA
LVVCGSVHQGVCEQRRLGQLEQLLLRPERPGDTQYVAANDPAVSTVGLVAQGLAGEPLLF
VGRGYTSRGVGGGIPPITTRALRPPDPQAAFSYEETAKLAVGRLSEYSHHFVSAFAHGAS
AYFLFLRRDLQAQSRAFRAYVSRVCLRDQHYYSYVELPLACKGGRYGLIQAAAVASSGEV
ARGEVLFAAFSSAAPPTVGRPPSAAAGASGASALCAFPLVEVDRLANRTRDACYTREGRA
ENGTEVAYIEYDVNSDCAQLPVDTLDAYPCGSDHTPSPMASRVPLEATPILEWPGVQLTA
VAVTMEDGHTIAFLGDSQGQLHRVYLGPGSNGHSYSTQSIQQGSAVSRDLTFDETFEHLY
VMTQSTLLKVPVASCAQHLDCASCLAHRDPYCGWCVLLGRCSRHSECSRGQGPEQWLWSF
QPEPACLQVTAMSPANISREERKEVFLSVPDLPPLWLGESYSCHFGDYDSPALLTGSGVM
CPSPDPSEAPVLQRGADHVSVSMELRFGAVVIAKASLSFYDCVAVTELRPSAQCQACVSS
RWGCNWCVWQHLCTHKASCDAGPMVVSQQSHLLSVAPPARDVPTPFPPIAPKTTITPAPD
TLPVESGAPSAATASDVPPGAGPSLLSPWGPWAGPSPVPFPASTESPLHEKPPTSSSPNR
PGTTAPAPTDFGPTATPEDLPAPHLSPSDTAAVSPADSGPEALPSAAPQDQPPGTAPATT
FPGATGSVKPALDWRMREGGELLEADEWMGGDAPAFSTSTLLSGDGDSAEQEGPPAPHIL
LSSLDYQYDTPGLWELEEVNWGASSCPCVESVQGSTLMPVHVEREVRLLGRNLRLFQDSP
GENECVMELEGLEVVVEAQVECEPPPDTWCHVTCQQHQLSYKAVQPELRVGLFLRRAGRL
RVDSAEGLHVVLYDCSVGHGDCSRCQTAAPQYGCVWCEGEHPRCVAWEACGEAEAVATQC
PAPLIHLVEPLTGPVDGGTRVTIRGSNLGQHVQDVLNTVRVAGVPCAVDAQEYEVSSSLV
CITGASGEEVAGAAAVEVPGRGRGVSEHSFAYQDPKVHSIFPTRGPRAGGTRLTLHGSKL
LTGRLEDIRVVVGDQPCHLLLEQQSEQLQCETSPYPVPATLPVAVWFGATERTLQRGLFK
YTSDPNVTSAGPTKSFLSGGRQIWVRGQNLDVVQMPRMRVTVAPGVLRPSQGLGQKRRMV
LETTCSPGASCDSHHFEEPCHVNSSQLIVCCTPALPGLPEDPWVQVEFILDNLVFDFATL
SPTPFSYEADPTLQPLNPEDPTTPFRHKPGSVFSVEGENLDLAMSKEEVVAMIGDGPCVV
KTLTRHHLYCEPPVEQPLPQHHALREAPDALPEFTVQMGNLRFSLGHVQYDGESSVAFPV
AAQVGLGVGTSLLALGVIVIVLMYRRKSKQALRDYKKVQIQLENLESSVRDRCKKEFTDL
MTEMTDLTSDLLGSGIPFLDYKVYAERVFFPGHRESPLHRDLGVPENRRPTVEQGLGQLS
NLLNSKLFLTKFIHTLESQRTFSARDRAYVASLLTVALHGKLEYFTDILRTLLSDLVAQY
VAKNPKLMLRRTETVVEKLLTNWMSICLYTFVRDSVGEPLYMLFRGIKHQVDKGPVDSVT
GKAKYTLNDNRLLREDVEYRPLTLNALLAVGPGAGEAQSVPVKVLDCDTISQAKEKMLDQ
LYKGVPLAQRPDPRTLDVEWRSGVAGHLILSDEDVTSEVQGLWRRLNTLQHYKVPDGATV
ALVPCLTKHILRENQDYVPGERTPMLEDVDEGGIRPWHLVKPSEEPEPPRPRRGSLRGGE
RERAKAIPEIYLTRLLSMKGTLQKFVDDLFQVILSTSCPVPLAIKYFFDLLDEQAQQHGI
SDQDTIHIWKTNSLPLRFWINIIKNPQFVFDVQTSDNMDAVLLVIAQTFMDACTLADHKL
GRDSPINKLLYARDIPRYKRMVERYYADIRQTVPASDQEMNSVLAELSRNCSGDLGARVA
LHELYKYINKYYDQIITALEEDGTAQKMQLGYRLQQIAAAVENKVTDL
Download sequence
Identical sequences XP_008572303.1.73410

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]