SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_008577472.1.73410 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_008577472.1.73410
Domain Number 1 Region: 230-485
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 2.65e-63
Family Eukaryotic proteases 0.00000013
Further Details:      
 
Domain Number 2 Region: 52-167
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 7.33e-22
Family Spermadhesin, CUB domain 0.00029
Further Details:      
 
Domain Number 3 Region: 196-238
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000877
Family Complement control module/SCR domain 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_008577472.1.73410
Sequence length 494
Comment PREDICTED: complement C1r subcomponent-like protein [Galeopterus variegatus]; AA=GCF_000696425.1; RF=representative genome; TAX=482537; STAX=482537; NAME=Galeopterus variegatus; AL=Scaffold; RT=Major
Sequence
MSGSRCLVPERGNSLWRSPHCTSCPGKMWWLLLWGVLQACPTQGSVLLAQRLPQQLTSPG
YPEPYLKGQEGTTDIQAPEGFVVRLVFQDFYLEPSQNCEGDSVTISASGMDPCRFCGQQG
SSLGSPPGQREFVSSGRSLRLTFHAHSSSEDKATHLHKSFLAFYQAVAVNGSQSTSHASG
GAEAVNTPGDHPSKNCCQEPYYQAVPAGTLTCTAQGTWKDRQDGPEIPHCVPVCGRPVTP
IAQNQKTLGSSRAKLGNFPWQAFTNIYGRGGGALLGDRWILTAAHTIYPKDGIFLGKNRS
VDVFLGHTDIEEMLKLGKYPVRRVVVHPDYRQNESHNFNGDIALLELQHRVSLGPNLLPV
CLPDNETLYLSGLLGYVSGFGMEMGWFTTKLKYSGFPVATRKDCEAWLRERQRTEVFSDN
MFCVGDKMWKHSVCQGDSGSVYVVWDNHSRRWVATGIVSWGIGCGEGYDFYTKVLNYVDW
IKGVMDGKDGPWGS
Download sequence
Identical sequences XP_008577472.1.73410

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]