SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_008587171.1.73410 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_008587171.1.73410
Domain Number 1 Region: 129-276
Classification Level Classification E-value
Superfamily Thioredoxin-like 7.38e-34
Family UAS domain 0.03
Further Details:      
 
Domain Number 2 Region: 313-443
Classification Level Classification E-value
Superfamily Ubiquitin-like 9.82e-21
Family UBX domain 0.0053
Further Details:      
 
Domain Number 3 Region: 10-48
Classification Level Classification E-value
Superfamily UBA-like 0.0000578
Family TAP-C domain-like 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_008587171.1.73410
Sequence length 445
Comment PREDICTED: FAS-associated factor 2 isoform X1 [Galeopterus variegatus]; AA=GCF_000696425.1; RF=representative genome; TAX=482537; STAX=482537; NAME=Galeopterus variegatus; AL=Scaffold; RT=Major
Sequence
MAAPEERDLTQEQTEKLLQFQDLTGIESMDQCRHTLEQHNWNIEAAVQDRLNEQEGVPSV
FNPPPSRPLQVNTADHRIYSYVVSRPQPRGLLGWGYYLIMLPFRFTYYTILDIFRFALRF
IRPDPRSRVTDPVGDIVSFMHSFEEKYGRAHPVFYQGTYSQALNDAKRELRFLLVYLHGD
DHQDSDEFCRNTLCAPEVISLINTRMLFWACSTNKPEGYRVSQALRENTYPFLAMIMLKD
RRMTVVGRLEGLIQPDDLINQLTFIMDANQTYLVSERLEREERNQTQVLRQQQDEAYLAS
LRADQEKERKKREERERKRRKEEEVQQQKLAEERRRRNLQEEKERKLECLPPEPSPDDPE
SVKIIFKLPNDSRVERRFHFSQSLTVIHDFLFSLKESPEKFQIEANFPRRVLPCIPSEEW
PNPPTLQEAGLSHTEVLFVQDLTDE
Download sequence
Identical sequences A0A096NF51 A0A0D9RAG2 A0A1D5QU10 A0A2K5CTW1 A0A2K5K7V3 A0A2K5KNZ9 A0A2K5S192 A0A2K5WSW1 A0A2K5XDQ6 A0A2K6B583 A0A2K6JNM4 A0A2K6N8Y4 E2R2I4 G3RM78 H2PHG4 H2QS26 M3XCS5
ENSPTRP00000029993 ENSGGOP00000016892 ENSPPYP00000017988 NP_001247827.1.72884 XP_002816290.1.23681 XP_002921783.1.58354 XP_003123708.1.46622 XP_003806885.1.60992 XP_003981277.1.62641 XP_004043102.1.27298 XP_004401493.1.74151 XP_004679306.1.23501 XP_005558650.1.63531 XP_006747979.1.47382 XP_007085577.1.5354 XP_008013563.1.81039 XP_008587171.1.73410 XP_008690565.1.72690 XP_010384687.1.97406 XP_011738446.1.29376 XP_011802224.1.43180 XP_011845392.1.47321 XP_011906486.1.92194 XP_012321782.1.9421 XP_014928201.1.86478 XP_017368282.1.71028 XP_017751625.1.44346 XP_019305943.1.44245 XP_021554256.1.83697 XP_518117.3.37143 XP_546218.2.84170 ENSPANP00000011539 9544.ENSMMUP00000011887 9598.ENSPTRP00000029993 9600.ENSPPYP00000017988 9615.ENSCAFP00000024535 9823.ENSSSCP00000014948 ENSMMUP00000011887 ENSMMUP00000011887 ENSFCAP00000024431 ENSPPYP00000017988 ENSPTRP00000029993 ENSCAFP00000024535 ENSGGOP00000005393 ENSCAFP00000024535

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]