SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_008593208.1.73410 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_008593208.1.73410
Domain Number 1 Region: 176-233
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.05e-23
Family Classic zinc finger, C2H2 0.0056
Further Details:      
 
Domain Number 2 Region: 233-289
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.7e-23
Family Classic zinc finger, C2H2 0.005
Further Details:      
 
Domain Number 3 Region: 430-486
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.1e-21
Family Classic zinc finger, C2H2 0.0086
Further Details:      
 
Domain Number 4 Region: 289-345
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.88e-21
Family Classic zinc finger, C2H2 0.0074
Further Details:      
 
Domain Number 5 Region: 541-598
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.41e-20
Family Classic zinc finger, C2H2 0.015
Further Details:      
 
Domain Number 6 Region: 330-382
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.65e-19
Family Classic zinc finger, C2H2 0.0064
Further Details:      
 
Domain Number 7 Region: 2-58
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.7e-18
Family KRAB domain (Kruppel-associated box) 0.00053
Further Details:      
 
Domain Number 8 Region: 475-527
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.56e-18
Family Classic zinc finger, C2H2 0.0043
Further Details:      
 
Domain Number 9 Region: 587-639
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.28e-16
Family Classic zinc finger, C2H2 0.0081
Further Details:      
 
Domain Number 10 Region: 372-427
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000164
Family Classic zinc finger, C2H2 0.019
Further Details:      
 
Domain Number 11 Region: 139-190
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000669
Family Classic zinc finger, C2H2 0.0068
Further Details:      
 
Domain Number 12 Region: 99-149
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000498
Family Classic zinc finger, C2H2 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_008593208.1.73410
Sequence length 641
Comment PREDICTED: zinc finger protein 709-like [Galeopterus variegatus]; AA=GCF_000696425.1; RF=representative genome; TAX=482537; STAX=482537; NAME=Galeopterus variegatus; AL=Scaffold; RT=Major
Sequence
MDSVAFEDVDVNFTLEEWALLDYSQKKLYRDVMGEIYTNLASIGKKWEDQKIEDQYKNNC
RNQSNHIVEKFDKVKESRDCGQTFSWIPNLNVNKNNSIVKPCGCILCEKVYMCSSPLNGH
IRSHSGPKSYENQEYGEQSYKCKVCGKGFECPSSCQSYEKMHSGEKPYECKQCGKAFRFS
SSLRRHKRSHTGEKPYECKECGKAFGFLSSIRRHERTHTGEKPYECKECGKAFGFLSSIR
RHERTHTGEKPYECKECGKAFSVSSSARKHERTHTGEKPYECKECGKAFGFLSSIRRHER
THSGEKPYKCKECGKAFSICRSAQTHERTHTEEKPYKCKECGKAFISLTQVRRHMIVHTG
DRPYKCKVCGKAFLCPSSLRMHERAHSGENHYACKQCDRVFRWPSSCRIHERSHIIEKPY
ECKKCGKKAFGSRTSFQEHERAHNGERPYECKKCGKAFNWLSSFRKHERTHSGEKPYECK
ECGKAFMFLAHVQRHMIVHTGDRPYKCNVCGKGFKYSSSFRTHERTHNERKHCECKECGK
VFISLASVQRHMVLHTGDGPYKCKLCGKVFVYPSSLHIHERNHTGEKRYECKQCGKAFGW
SKSLRIHETVHSGEKPYECKHCGKAFSAHCSFRRHEKIHTG
Download sequence
Identical sequences XP_008593208.1.73410

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]