SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_008615804.1.67053 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_008615804.1.67053
Domain Number 1 Region: 476-602
Classification Level Classification E-value
Superfamily Bet v1-like 8.79e-23
Family STAR domain 0.017
Further Details:      
 
Domain Number 2 Region: 207-288
Classification Level Classification E-value
Superfamily PH domain-like 0.000000000261
Family Pleckstrin-homology domain (PH domain) 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_008615804.1.67053
Sequence length 621
Comment hypothetical protein SDRG_11541 [Saprolegnia diclina VS20]; AA=GCF_000281045.1; RF=representative genome; TAX=1156394; STAX=112098; NAME=Saprolegnia diclina VS20; strain=VS20; AL=Scaffold; RT=Major
Sequence
MLPTTSPRAPATLARGRSSSKLAEPDPFSRRSPSMPPAATGSPVRLNRRPASFHGPQEFG
ESSAPSPDASSNNEDISMLFDMICNDYFTARYASSESGIHILEASLVKLWKVIMLPEKTV
SAKMAARISKFCEDMAKESLVKEADARAAVARQASDMDADLQVEGLLRDWIKPKLLVLVE
EMRLERALRGASSSGRSVPAGEDVASLGEIRIEGYLRKKGQHVNLWRERYFMIRSAPNGT
HILCYFRKKGDREPRGPGCTVDEVRESPSLMESKRLFTFRIRHYSSTYSEESEEYNEAMP
MTPLATPGTTSGDGFDFDFDPKANIKKARMKKLAAAATAATAVVLTGGLAGIGLVGVGAA
AVSSAALTASASTLLTKSSVAPLSLAAESLETALWWRNSILECIAQAEAHWRQYVHWYLA
QDRDVDEATESPLPPTSPPTSKTPKTTRAIAPPPKIVRRPSLGSLPRSMLKQFRWLQGLD
RWSLYTQNSNLRVYAHPVPSPAWPPMKASLHIPASSQRVLDMLLQTDSPFYKSNCLLKRS
YVLEAVDAHTDIVYWKLSPQSLWPVVVEARDFCLLRYWHQEPDGSYIIWFHSVQHSDCPP
THELLGFFAILYTISWLKQQI
Download sequence
Identical sequences T0QB70
XP_008615804.1.67053

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]