SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_008621701.1.67053 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_008621701.1.67053
Domain Number 1 Region: 173-259
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000000588
Family Pleckstrin-homology domain (PH domain) 0.0077
Further Details:      
 
Domain Number 2 Region: 444-533
Classification Level Classification E-value
Superfamily Bet v1-like 0.00000000357
Family STAR domain 0.057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_008621701.1.67053
Sequence length 536
Comment hypothetical protein SDRG_17239, partial [Saprolegnia diclina VS20]; AA=GCF_000281045.1; RF=representative genome; TAX=1156394; STAX=112098; NAME=Saprolegnia diclina VS20; strain=VS20; AL=Scaffold; RT=Major
Sequence
MLPAATESPVRLNRRPASFHGPQEFGESSAPSPDTSSNNEDISMLFDMICNDYFTARYAS
SESGIHILEASLVKLWKVIMLPEKTVSAKMAARISKFCEDMAKESLVKEAEARAAVARQA
SDMDADLQVEDLLRDWIKPKLLVLVEEMRLERALRGASSSGRSVPAGEDVASLGEIRIEG
YLRKKGQHVNLWRERYFMMRSAPNGTHILCYFRKKGDREPRGWYALGPGCTVDEVRESPS
LMESKRLFTFRIRHYSSTYSEESEEYNEAMPMTPLATPGTTSGDGFDFDFDPKANIKKAR
MKKLAAAATAVVLTGGLAGIGLVGVGAAAVSSAALTASASTLLTKSSVAPLSLAAESLET
ALWWRNSILECIAQAEAHWHQYVHWYLAQDRDVDEATESRLPPTSPPTSKTPKTTRAIAP
PPKIVRRPSLGSLPRSMLKQFRWLQGLDRWSLYAQNSNLRVYAHPVPSPAWPPMKASLHI
PASSQRVLDMLLQMDSPFYKSNCLLKRSYVLEAIDAHTDIVYWKLSPQSLWPVVVE
Download sequence
Identical sequences T0R5U8
XP_008621701.1.67053

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]