SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_008623296.1.22292 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_008623296.1.22292
Domain Number 1 Region: 528-582
Classification Level Classification E-value
Superfamily RING/U-box 0.00000000000000169
Family RING finger domain, C3HC4 0.0062
Further Details:      
 
Domain Number 2 Region: 352-448
Classification Level Classification E-value
Superfamily Cdc48 domain 2-like 0.0000000000000036
Family Cdc48 domain 2-like 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_008623296.1.22292
Sequence length 584
Comment hypothetical protein YYE_01396 [Plasmodium vinckei vinckei]; AA=GCF_000709005.1; RF=representative genome; TAX=54757; STAX=5860; NAME=Plasmodium vinckei vinckei; strain=vinckei; AL=Scaffold; RT=Major
Sequence
MERKSGKSKYMHFLPIINSQTKLNILEKNNILEKVHILPIKKRTTNVHELYNKLNELINE
KSVLYEGVVISLKDDSEYSDLKISKIPNINEKDESIKKKLDNDTLFGIDKVSTDESSADE
SQTSDMLLPLNDDEKNINKIDSDNFKNNVKKEKTSQLLDNNVDYVIINCIPSKGILNHDT
LIYTNGKYVDYLKKIEIIIINDKNYKKYEKTIKRKFVSFKKMILKKSNEFFNGAMSLFPL
YFNFIPELCMSKSRNKVSKNEQCSIEKIVNHTTINEYNTKKKERKKINKIVIQNFLMNHL
IPYFKNNKNKLFYPGKLFNVNNFSFLVSKIDIDISAGFIDDLTEINLRVDSYEEYNNVHI
VPLYDTLPTTYNYNLFIDYIKPYIERHYLSTFSLYDTFFYRGVQFKIMGVDPIDMESGKG
RISANTSIYTQGSVKPTFFDVISTKSFNYIKSLPFEYKPYAILNILQHLDTDSLLRLFPS
ANINMESSTKNEKTILDHLSPLMYEYNKETTSYDPKNIIIGQRNMQSENNNNIINEQCAV
CFEHFINNDKCIKLTCLHTYHWKCVQNWFRFNLTCPCCRHKLRI
Download sequence
Identical sequences XP_008623296.1.22292

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]