SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_008677752.1.34533 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_008677752.1.34533
Domain Number 1 Region: 357-439
Classification Level Classification E-value
Superfamily Ubiquitin-like 7.51e-16
Family UBX domain 0.036
Further Details:      
 
Domain Number 2 Region: 51-183
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.000000000000019
Family Glutathione peroxidase-like 0.075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_008677752.1.34533
Sequence length 583
Comment uncharacterized protein LOC100502378 isoform X1 [Zea mays]; AA=GCF_000005005.2; RF=representative genome; TAX=4577; STAX=4577; NAME=Zea mays; cultivar=B73; AL=Chromosome; RT=Major
Sequence
MMHQNETPSLVVRPFHLPFAQRVLPLVRQLGDRRRRSTPGAQAFVRTFSGLHRVLRRRRS
PTRMERTINSLMYKGSIPDAINQSRREKKLFVVYISGEDEASSSLEQSSLIDENVVEVIG
RCCILLHLKQGNVDASQFSAIYPQKSVPSISVIGLNGVLLWNHDGYINSENLKESIEKAW
AALHLQETAATLLTASLATRNSEPVNSATTVLPAQGGSSTLENPSDLSSQSPDVSGASEV
AHSTDLVSQIPNSTALYEPLEINEKEGSKSNSDDKTVEKLGSTSTEFDCDLLDSSRKSNT
VSSADSKGEDITPSAKRKNKDDGSHTSIPLEDTPSTLTNKGVSSQSRVEQDKATSFVSVK
SDDIQLSIRMPSGNRLEIKLTKQDVLRKVKNFVDENQGNGLGSYDLSLVYPKRVFFEQDM
EATLSELGIQNRHAMIVVPHRQSGQVSRRHSSASYDMGVNSGADDVGGNSGAGGYFGYLR
TVLSYVNPLSYLRGNTNSSNTELQSNEGLRQLRHGSGPWSEPRPLGNRGHEVTDADSANT
LRRRPRPFGANIHTLGSEDHGPSDERNVFWNGNSTEFGGDDRK
Download sequence
Identical sequences XP_008677752.1.34533

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]