SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_008688614.1.72690 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_008688614.1.72690
Domain Number 1 Region: 40-180
Classification Level Classification E-value
Superfamily PH domain-like 0.000000000000632
Family Phosphotyrosine-binding domain (PTB) 0.0098
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_008688614.1.72690
Sequence length 203
Comment PREDICTED: PTB-containing, cubilin and LRP1-interacting protein isoform X5 [Ursus maritimus]; AA=GCF_000687225.1; RF=representative genome; TAX=29073; STAX=29073; NAME=Ursus maritimus; AL=Scaffold; RT=Major
Sequence
MLKSKLNVLTLKKEPLPAVIFHEPEAIELCTTTPLMKTRTHSGCKVTYLGKVPTTGMQFL
SGCTEKPVIELWKKHTLAREDVFPANALLEIRPFQVWLHHLDHKGEATVHMDTFQVARIA
YCTADHNVSPNIFAWVYREINDDLSYQMDCHAVECESKLEAKKLAHAMMEAFKKTFHSMK
SDGRIHRNSSSEEVSQELESDDG
Download sequence
Identical sequences J9P3K5
ENSCAFP00000040134 XP_008688614.1.72690 XP_019512661.1.44202 ENSCAFP00000040134

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]