SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_008703911.1.72690 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_008703911.1.72690
Domain Number 1 Region: 2200-2293
Classification Level Classification E-value
Superfamily C-type lectin-like 2.5e-30
Family Link domain 0.00014
Further Details:      
 
Domain Number 2 Region: 1575-1728
Classification Level Classification E-value
Superfamily FAS1 domain 2.88e-29
Family FAS1 domain 0.0016
Further Details:      
 
Domain Number 3 Region: 975-1128
Classification Level Classification E-value
Superfamily FAS1 domain 6.67e-27
Family FAS1 domain 0.0015
Further Details:      
 
Domain Number 4 Region: 521-654
Classification Level Classification E-value
Superfamily FAS1 domain 3.01e-24
Family FAS1 domain 0.0017
Further Details:      
 
Domain Number 5 Region: 1742-1884
Classification Level Classification E-value
Superfamily FAS1 domain 6.02e-23
Family FAS1 domain 0.0043
Further Details:      
 
Domain Number 6 Region: 1133-1264
Classification Level Classification E-value
Superfamily FAS1 domain 4.84e-21
Family FAS1 domain 0.0067
Further Details:      
 
Domain Number 7 Region: 2290-2450
Classification Level Classification E-value
Superfamily FAS1 domain 3.79e-20
Family FAS1 domain 0.007
Further Details:      
 
Domain Number 8 Region: 337-503
Classification Level Classification E-value
Superfamily FAS1 domain 6.02e-20
Family FAS1 domain 0.0032
Further Details:      
 
Domain Number 9 Region: 1518-1556
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000044
Family Merozoite surface protein 1 (MSP-1) 0.057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_008703911.1.72690
Sequence length 2552
Comment PREDICTED: LOW QUALITY PROTEIN: stabilin-2 [Ursus maritimus]; AA=GCF_000687225.1; RF=representative genome; TAX=29073; STAX=29073; NAME=Ursus maritimus; AL=Scaffold; RT=Major
Sequence
MLQNLILFLLGLVVHNSCSLPETTDQAKRCDKKSLLTVRTECQSCSLNVGTKCPDGYTKV
TNGSVGVRDCRYIFEIRKYSLSLPGCRHICRKDYVQPQCCPGHWGPDCMECPGGASSPCS
GRGSCAEGMEGNGSCSCQDGFGGTACETCADDNLFGPSCSAVCSCVHGVCNSGIDGDGSC
ECYSAYTGPNCDKPIPECAALLCPENSRCSPSSQDETKLECKCLPNYQGDGRYCEPINPC
LQAVCHPHAHCTYLGPNQHSCTCLEGYHGDGQVCLPVDPCQTHYGNCPTESTVCIYDGPG
QSHCECKEHYRNYVPGVGCSVIDVCESNNPCHRNANCTTIAPGQPKCTCQKGYVGDGSTC
YGNIMERLRELNTEPRGKWQGSLTSFISLLDKAYAWPLSNLGPFTVLLPTDKGLKGFNVK
ELLMDKEAAQYFVKLHIIAGQMNTERMNNTDTFYTLTGKSGEIFNGDKDNQIKLKLYGGK
KKVKIIQGDIVASNGLLHILDRAMDKMAPTFESNTEQTIMTLLQPRYSKFRSLLEETNVG
HTLDEDGTNGPYTIFVPSNEALNNMKDGTLDYLLSPEGSRKLLELVRYHIVPFTQLEVGT
LIVTPHIRSLANQIIQFNTTNNGQILANDVAIEETEVIAKNGRIYTLTGVLIPPSIVPIL
PHRCDESKREMKLGTCVSCSLVYWSKCPANSEPTTLFTHRCVYTGRVRSLKSGCARYCNA
TVEIPKCCKGFYGPDCNQCPGGFSNPCSGNGQCADGLDGNGTCICQDGFHGSQCQFCSDP
NKYGPRCDKECLCIYGTCDNRIDSDGACLAGTCREGSAGRFCHKQTSTCGPYMHFCHIHA
TCEYSNGTASCVCKAGYEGDGNLCSETDPCAGTTPGGCSRNAECIRTGVGTHTCVCQQGW
TGDGRDCSEINNCLLPGTGGCHANATCLYVGPGQNECECKEGFRGNGIDCEAVTSCLEQT
GNCHPLATCQFTSSGLWSCVCQEGYEGDGLLCYGNAAVELSFLSAAAIFNQWINNASLQP
MLSAASNLTVLAPSQQAIKDMDQDEKTFWLSKSNIPALIKNHVLLGMYGVADLQALSPSD
MLATSLPGNFLHLAKADGNITIEGASVIDGDNTATNGVIHIINKVLVPQRSLTVSLPNLI
TRLDQMPDYSIFRGYIIQYNLASAIEAANTYTVFAPSNNAIKSYIQEKKVATLEEDVLRY
HVILEEKLLKNDLHHGMHRETMLGFSYLLGFFLHNDQLYVNEAPINYTNAATDKGVIHGL
GKVLEIQKNRCDNNDTTIVRGKCGACLQQPICPFGTKQLGEEIRRCIYTIYFMGKRSLFI
GCQPKCVKAIITRECCAGFFGPQCQACPGKAENVCFGNGICLDGVNGTGVCECGAGFAGT
ACESCTEGKYGPHCDQVCSCVHGRCNQGPSGDGSCDCDAGWRGVRCDTEITKDDCNGICH
TSANCLLNPDGTASCKCAAGFQGNGTVCTGKRGRGLLGGTASASCXEADCKRPPPGSRQC
VCRAGYTGDGVVCLEINPCLENNGGCHKNAECTQTGPNQAVCNCLPKYTGDGKVCSFINT
CLTKNGGCSEFAICNHTGPEERTCTCKAEYTGDGFTCRGNIYQELPRNPKTSQYFFQLLE
HSVRDLSGPGPFTVFAPLSAAFDEEPRIKDWDKKGFMPQVLRYHVIACHQLLLENLKLIP
NATSLQGEKIFISVSQDTVYINNKAKIISSDIIHTNGIIHIIDKLLSPQNLLITPKDASG
RILQNLTTVAVNHGYTKFSSLLQDVGLLGVITDPVHAPITLFWPSDQALQTLPPEQQDFL
FNQENKDKLMEYLKFHVIRESKILAVGLPRATAWKTLQGSELRVTCGAGGDIGELFLNDQ
TCRIVQRELLFDLGVAYGIDCLLIDSTLGGHCDTFAAYNFSGDCWSCANTPSCPKWSKSK
GVKEKCRYYSAFSGYLEGCREQCTMVLRLPKCCKGYFGRDCQACPGGADTPCNNHGFCLD
QYLGIGECRCHMGFNGTACELCLPGRFGPDCQSCGCSAHGQCDDGITGSGQCFCETGWTG
RFCNTQTALAPVCTPSCSAHATCKENNTCECNLNYEGDGITCTVVDFCKQNNGGCAKVAR
CSQKGTKVSCSCLKGYKGDGRSCTEIDPCADGLNGGCHEHATCKMTGPGKHKCECKSHYV
GDGLDCEPERLPVDRCLQDNGQCHADAECADLHFQDTTLGVFHLRSPLGQYKLTFDKARE
ACANEAASMATYNQLSYAQKAKYHLCPAGWLESGRVAYPTAYASQNCGSGVVGIIDYGQR
NNKSEMWDVFCYRIKDVNCTCKAGYVGDGFSCSGNLLQVLMSVPSLTNFLTEVLAYSNSS
ARGRAFLNHLTDLSVRNTLFVPHNSGLGENETLSGRDIEHHLANVSVFFYNDLVNGTVLR
TKLGSQLLITSSQDQRQPETRFVDGRAILQWDIFASNGIIHVISRPLKAPPAPLSSAHTG
MGTGIFFATVLVFGAATLAAYSYFRLSRRAAGFQHFESEEDIDVAALGNQQPENIPNPLY
ESTPSAPPEPSCDHFMDAEDRQPDNNDPLGAL
Download sequence
Identical sequences XP_008703911.1.72690

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]