SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_008703979.1.72690 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_008703979.1.72690
Domain Number 1 Region: 54-797
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.21e-273
Family Motor proteins 0.00000000000000153
Further Details:      
 
Domain Number 2 Region: 798-923
Classification Level Classification E-value
Superfamily Myosin rod fragments 4.88e-22
Family Myosin rod fragments 0.00031
Further Details:      
 
Domain Number 3 Region: 918-1034
Classification Level Classification E-value
Superfamily Myosin rod fragments 1.13e-20
Family Myosin rod fragments 0.0011
Further Details:      
 
Domain Number 4 Region: 1204-1311
Classification Level Classification E-value
Superfamily Myosin rod fragments 9.29e-18
Family Myosin rod fragments 0.0027
Further Details:      
 
Domain Number 5 Region: 1021-1113
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.000000000929
Family Myosin rod fragments 0.0035
Further Details:      
 
Domain Number 6 Region: 1476-1589
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.00000000235
Family Myosin rod fragments 0.0011
Further Details:      
 
Domain Number 7 Region: 1311-1413
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0000000602
Family Myosin rod fragments 0.0098
Further Details:      
 
Domain Number 8 Region: 1721-1822
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 0.00004
Family Regulator of G-protein signaling, RGS 0.0081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_008703979.1.72690
Sequence length 1876
Comment PREDICTED: LOW QUALITY PROTEIN: myosin-9 [Ursus maritimus]; AA=GCF_000687225.1; RF=representative genome; TAX=29073; STAX=29073; NAME=Ursus maritimus; AL=Scaffold; RT=Major
Sequence
MAQQAADKYLYVDKNFINNPLAQADWAAKKLVWVPSDKSXKPASLKEEVGEEAIVELVEN
GKKVKVNKDDIQKMNPPKFSKVEDMAELTCLNEASVLHNLKERYYSGLIYTYSGLFCVVI
NPYKNLPIYSEEIVEMYKGKKRHEMPPHIYAITDTAYRSMMQDREDQSILCTGESGAGKT
ENTKKVIQYLAHVASSHKSKKDQGELERQLLQANPILEAFGNAKTVKNDNSSRFGKFIRI
NFDVNGYIVGANIETYLLEKSRAIRQAKEERTFHIFYYLLSGAGEHLKTDLLLEPYNKYR
FLSNGHVTIPGQQDKDMFQETMEAMRIMGIPEEEQMGLLRVISGVLQLGNIVFKKERNTD
QASMPDNTAAQKVSHLLGINVTDFTRGILTPRIKVGRDYVQKAQTKEQADFAIEALAKAT
YERMFRWLVLRINKALDKTKRQGASFIGILDIAGFEIFDLNSFEQLCINYTNEKLQQLFN
HTMFILEQEEYQREGIEWNFIDFGLDLQPCIDLIEKPAGPPGILALLDEECWFPKATDKS
FVEKVVQEQGTHPKFQKPKQLKDKADFCIIHYAGKVDYKADEWLMKNMDPLNDNIATLLH
QSSDKFVSELWKDELPLNAILLLEWLRVSQHEVEESCALLCAGKLDPHLVLDQLRCNGVL
EGIRICRQGFPNRVVFQEFRQRYEILTPNSIPKGFMDGKQACVLMIKALELDSNLYRIGQ
SKVFFRAGVLAHLEEERDLKITDVIIGFQACCRGYLARKAFAKRQQQLTAMKVLQRNCAA
YLKLRNWQWWRLFTKVKPLLQVSRQEEEMMAKEEELVKVREKQLAAENRLTEMETLQSQL
MAEKLQLQEQLQAETELCAEAEELRARLTAKKQELEEICHDLEARVEEEEERCQHLQAEK
KKMQQNIQELEEQLEEEESARQKLQLEKVTTEAKLKKLEEDQIIMEDQNCKLAKEKKLLE
DRIAEFTTNLMEEEEKSKSLAKLKNKHEAMITDLEERLRREEKQRQELEKTRRKLEGDST
DLNDQIAELQAQIAELKMQLAKKEEELQAALARVEEEASQKNMALKKIRELESQISELQE
DLESERASRNKAEKQKRDLGEELEALKTELEDTLDSTAAQQELRSKREQEVNILKKTLED
EAKTHEAQIQEMRQKHSQAVEELAEQLEQTKRVKANLEKAKQTLENERGELANEVKVLLQ
GKGDSEHKRKKAEAQLQELQVKFTEGERVRTELADKVTKLQVELDNVTGLLSQSDSKSSK
LTKDFSALESQLQDTQELLQEENRQKLSLSTKLKQMEDEKNSFKEQLEEEEEAKRNLEKQ
IATLHAQVTDMKKKMEDGVGCLETAEEAKRKLQKDLEGLGQRYEEKVAAYDKLEKTKTRL
QQELDDLLVDLDHQRQTASNLEKKQKKFDQLLAEEKTISAKYAEERDRAEAEAREKETKA
LSLARALEEAMEQKAELERLNKQFRTEMEDLMSSKDDVGKSVHELEKSKRALEQQVEEMK
TQLEELEDELQATEDAKLRLEVNLQAMKAQFERDLQGRDEQSEEKKKQLVRQVREMEAEL
EDERKQRSMAVAARKKLEMDLKDLEAHIDSANKNRDEAIKQLRKLQAQMKDYMRELEDTR
ASREEILAQAKENEKKLKSMEAEMIQLQEELAAAERAKRQAQQERDELADEIANSSGKGA
LALEEKRRLEARIAQLEEELEEEQSNTELVNDRLKKANLQIDQINTDLNLERSHAQKNEN
LRQQLERQNKELKVKLQEMEGAVKSKYKASITALEAKIAQLEEQLDNETKERQAACKQVR
RAEKKLKDVLLQVDDERRNAEQFKDQVCVRASCASVPRRGDLPFVVPRRMARKGAGDCSD
EEVDGKADGAEAKAAE
Download sequence
Identical sequences XP_008703979.1.72690

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]