SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_008704683.1.72690 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_008704683.1.72690
Domain Number 1 Region: 493-550
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.5e-25
Family Classic zinc finger, C2H2 0.0045
Further Details:      
 
Domain Number 2 Region: 606-662
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.67e-24
Family Classic zinc finger, C2H2 0.0052
Further Details:      
 
Domain Number 3 Region: 437-494
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.89e-24
Family Classic zinc finger, C2H2 0.0054
Further Details:      
 
Domain Number 4 Region: 381-438
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.79e-24
Family Classic zinc finger, C2H2 0.0049
Further Details:      
 
Domain Number 5 Region: 325-382
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.36e-23
Family Classic zinc finger, C2H2 0.0049
Further Details:      
 
Domain Number 6 Region: 549-606
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.42e-23
Family Classic zinc finger, C2H2 0.0039
Further Details:      
 
Domain Number 7 Region: 18-76
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 7.85e-22
Family KRAB domain (Kruppel-associated box) 0.0011
Further Details:      
 
Domain Number 8 Region: 651-703
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.79e-17
Family Classic zinc finger, C2H2 0.0075
Further Details:      
 
Domain Number 9 Region: 273-326
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000973
Family Classic zinc finger, C2H2 0.015
Further Details:      
 
Domain Number 10 Region: 213-267
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000194
Family Classic zinc finger, C2H2 0.016
Further Details:      
 
Domain Number 11 Region: 112-159
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000102
Family Classic zinc finger, C2H2 0.033
Further Details:      
 
Domain Number 12 Region: 171-220
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000641
Family Classic zinc finger, C2H2 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_008704683.1.72690
Sequence length 704
Comment PREDICTED: zinc finger protein 132 isoform X1 [Ursus maritimus]; AA=GCF_000687225.1; RF=representative genome; TAX=29073; STAX=29073; NAME=Ursus maritimus; AL=Scaffold; RT=Major
Sequence
MDPGQSFHWPPGLVLSSLRSPVTFEDVAVYFSKEEWGLLDASQRHLYHNVMLENFELMTS
LGCWHGVEDEGDHSKQNTSVEGMSQVRIPSANPSTQKADTCDMCGPFLKDILHLDEHQGT
YPEETLYTCGTCGREFWFSANLHQHQKELSGEKPFRWDKDKDSFVENLTVHLSEKPFTCG
EGGKDALDSHDFFQHSAIDSSRKPQRTTECRETFSHSSNLEQLPEVHTTQKLFKCSNCGK
AFQKTSTLLSHLRTHSKETPFRCPTVGNSLEEKSTLVNHQKYHDRETCHVCKACGKTFSH
PSKLRKHQKFHTGVKHYECSDCGKTFNHKLTLVHHQRIHTGERPYECSECGKAFNNRSHL
TRHEKVHTGERPFECSKCGRAFSQSSNFLRHQKVHTQVRPYECNQCGKAFSRSSALIQHW
RVHTGERPYECSECGRAFNNNSNLAQHQKVHTGERPFECSECGRDFSQSSHLLRHQKVHT
GERPFECTECGKAFSNSSTLIQHQKVHTGQRPYECSECRKAFSRSSSLIQHWRIHTGERP
YECSECGKAFAHSSTLIEHWRVHTRERPYECSECGKFFSQNSILIKHQKVHTGERPYECS
KCGKFFSRKSSLIYHWRVHTGERPYECSECGRAFSNNSHLVRHQRVHTQERPYECSQCGK
AFSERSTLVRHQIVHTRERTYECGHCGKIFSRLCNLAQHKRIHN
Download sequence
Identical sequences XP_008704683.1.72690

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]