SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_008709453.1.72690 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_008709453.1.72690
Domain Number 1 Region: 393-449
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.35e-22
Family Classic zinc finger, C2H2 0.0084
Further Details:      
 
Domain Number 2 Region: 308-365
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.84e-22
Family Classic zinc finger, C2H2 0.0074
Further Details:      
 
Domain Number 3 Region: 532-589
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.4e-21
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 4 Region: 224-281
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.13e-21
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 5 Region: 476-533
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.42e-20
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Domain Number 6 Region: 33-88
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 9.68e-20
Family KRAB domain (Kruppel-associated box) 0.00042
Further Details:      
 
Domain Number 7 Region: 578-630
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.8e-19
Family Classic zinc finger, C2H2 0.0059
Further Details:      
 
Domain Number 8 Region: 174-225
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.2e-18
Family Classic zinc finger, C2H2 0.0078
Further Details:      
 
Domain Number 9 Region: 131-182
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000741
Family Classic zinc finger, C2H2 0.0078
Further Details:      
 
Domain Number 10 Region: 439-470
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000989
Family Classic zinc finger, C2H2 0.0087
Further Details:      
 
Domain Number 11 Region: 271-303
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000141
Family Classic zinc finger, C2H2 0.018
Further Details:      
 
Domain Number 12 Region: 355-387
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000298
Family Classic zinc finger, C2H2 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_008709453.1.72690
Sequence length 632
Comment PREDICTED: zinc finger protein 14-like isoform X5 [Ursus maritimus]; AA=GCF_000687225.1; RF=representative genome; TAX=29073; STAX=29073; NAME=Ursus maritimus; AL=Scaffold; RT=Major
Sequence
MRSAHLSRLRCHGEHGAERRDDVSIVFHRSVYLYDSVVFEDVAVDFTLDEWALLDSMQKN
LYRDVMLETFQNLVSVEKNWEDHSIEDQHGNHSRHLRNPVTDRFCESNERNQHRETCSQF
PHFNFCKNISTGVKLYECTKCGRGFMHLSSLKRHVRSHCGQKPYPCQACKQACICRAHLR
THTGQKPYGCKLCGKTFPYFYSLTQHIRIHTPEKNYECKQCGKTFHEFSSLTRHAKTHSR
EKPYKCKECGKAFIYPSIFQRHTVTHTGERPYECKLCGKAFHHSYSLTQHMKIHTSEKTY
ECKQCRQAFSQFSSFTGHVRTHTGEKPYNCKECGKVFIYPSVFQRHLITHTGEKPYECKL
CGKMFRHPYSLAQHKKSHTAEKTYECKQCSTAFHEFASLTRHERTHTGEKPYKCMECGKA
FTYPSTFQRHMMTHIGEKPYECKQCGKTFSYPQSSQRHEKTHTGEKPYKCTECGKAFSWP
ETYHVHVRTHTGEKLHNCEHCGKAFSSPKSFQGHVRTHTGEKPYKCKQCGKAFSWPSTFR
EHERIHNEEKLYKCENCGRAFTSSRSFQGHMRTHTGEKPYECAQCGKAFSWSSSLQKHVR
THTGEKPHTCKHCGKAFKWPSSFRNHVRTHTG
Download sequence
Identical sequences XP_008709453.1.72690

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]