SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_008759392.1.100692 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_008759392.1.100692
Domain Number 1 Region: 216-279
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.00000000000000214
Family B-box zinc-binding domain 0.0016
Further Details:      
 
Domain Number 2 Region: 546-612,652-737
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.000000000000686
Family SPRY domain 0.024
Further Details:      
 
Domain Number 3 Region: 425-529
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000000000782
Family Fibronectin type III 0.0039
Further Details:      
 
Domain Number 4 Region: 25-74
Classification Level Classification E-value
Superfamily RING/U-box 0.0000000000278
Family RING finger domain, C3HC4 0.035
Further Details:      
 
Weak hits

Sequence:  XP_008759392.1.100692
Domain Number - Region: 167-202
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.0398
Family TFIIH p44 subunit cysteine-rich domain 0.077
Further Details:      
 
Domain Number - Region: 265-341
Classification Level Classification E-value
Superfamily Apolipoprotein A-I 0.0445
Family Apolipoprotein A-I 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_008759392.1.100692
Sequence length 759
Comment PREDICTED: tripartite motif-containing protein 46 isoform X1 [Rattus norvegicus]; AA=GCF_000001895.5; RF=representative genome; TAX=10116; STAX=10116; NAME=Rattus norvegicus; strain=mixed; AL=Chromosome; RT=Major
Sequence
MAEGEDMQTFTSIMDALVRISTSMKNMEKELLCPVCQEMYKQPLVLPCTHNVCQACAREV
LGQQGYIGHGGDPSSEPTSPASTPSTRSPRLSRRTLPKPDRLDRLLKSGFGTYPGRKRGA
LHPQTILFPCPACQGDVELGERGLSGLFRNLTLERVVERYRQSVSVGGAILCQLCKPPPL
EATKGCSECRATFCNECFKLFHPWGTQKAQHEPTLPTLSFRPKGLMCPDHKEEVTHYCKT
CQRLVCQLCRVRRTHSGHKITPVLSAYQALKDKLTKSLAYILGNQDTVQTQICELEETIR
HTEVSGQQAKEEVSQLVRGLGAVLEEKRSSLLQAIEECQQERLSRLSAQIHEHQSLLDGS
GLVGYAQEVLKETDQPCFVQAAKQLHNRIARATEALQTFRPAASSSFRHCQLDVGREMKL
LTELNFLRVPEAPVIDTQRTFAYDQIFLCWRLPPHSPPAWHYTVEFRRTDVPAQPGPTRW
QRREEVRGTSALLENPDTGSVYVLRVRGCNKAGYGEYSEDVHLHTPPAPVLHFFLDGRWG
ASRERLAISKDQRAVRSIPGLPLLLAAERLLTGCHLSVDVVLGDVAVTQGRSYWACAVDP
ASYLVKVGVGLESKLQESFQGAPDVISPRYDPDSGHDSGAEDAAVEALPPFAFLTIGMGK
ILLGSGASSNAGLTGRDGPAASCTVPLPPRLGICLDYERGRVSFLDAVSFRGLLECPLDC
SGPVCPAFCFIGGGAVQLQEPVGTKPERKVTIGGFAKLD
Download sequence
Identical sequences A0A0G2JXN2
XP_008759392.1.100692 10116.ENSRNOP00000030634 ENSRNOP00000053556

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]