SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_008767188.1.100692 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_008767188.1.100692
Domain Number 1 Region: 146-207
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 2.88e-26
Family KRAB domain (Kruppel-associated box) 0.0016
Further Details:      
 
Domain Number 2 Region: 374-430
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.66e-22
Family Classic zinc finger, C2H2 0.0051
Further Details:      
 
Domain Number 3 Region: 854-910
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.96e-21
Family Classic zinc finger, C2H2 0.0064
Further Details:      
 
Domain Number 4 Region: 741-798
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.31e-20
Family Classic zinc finger, C2H2 0.0077
Further Details:      
 
Domain Number 5 Region: 895-947
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.46e-20
Family Classic zinc finger, C2H2 0.0039
Further Details:      
 
Domain Number 6 Region: 430-486
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.79e-20
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 7 Region: 798-854
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.21e-19
Family Classic zinc finger, C2H2 0.0084
Further Details:      
 
Domain Number 8 Region: 704-755
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000121
Family Classic zinc finger, C2H2 0.0071
Further Details:      
 
Domain Number 9 Region: 338-387
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000195
Family Classic zinc finger, C2H2 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_008767188.1.100692
Sequence length 1016
Comment PREDICTED: zinc finger protein 316 isoform X1 [Rattus norvegicus]; AA=GCF_000001895.5; RF=representative genome; TAX=10116; STAX=10116; NAME=Rattus norvegicus; strain=mixed; AL=Chromosome; RT=Major
Sequence
MMAALHTAPDSPDTQLEPAEDGSECDAEPEEEEEEEEEDDEQGREEEEVVVEEEVATQVQ
EAAGVEVEANSADTGGGDDGDDGDVEEVLAEEQTLSLGTQKRLSNGADAKSPALQGKALQ
ASRLPPTTQGDDPEEEEEEEDDEHFLTQGLVTFEDVAVYFSLEEWERLDVDQRDLYRDVM
QENYGILVSLGYPIPKPDLIFHLEQGEEPWVEDSPHPEEGDVVTGVYTGAWFWNDDLEDH
EEEDDEDFLAEMAEEENEPPGLWSAAYGVGDVPGTWGPDDSDSVQTPEGWGPNPGSLGIL
AEEVEAKHFLSGRGPGENFLVPWAFPAVAVPIGCPETTCDVCGKVFPHRSRLAKHQRYHA
AVKPFGCEECGKGFVYRSHLAIHQRTHTGEKPFPCPDCGKRFVYKSHLVTHRRIHTGERP
YRCVFCGAGFGRRSYLVTHQRTHTGERPYPCLHCGRSFSQSSALARHQAVHTADRPHCCP
DCGQAFRLRADFQRHRRGGGCTEPSSGDGALTAPHEVGMAPNEVEMAIAAVATAEPEELE
SGLAEKNEEPKAGVADGDNEVEVRQDEQVVVAAAAEATVPDSKKDPEPDRRFREMGNGLA
EGEGPSSHRFGFHFPMHPKSWLHPDGFPLLGFPEFSERLQTDGRHLPGPLGAPLSLQGMG
LACDPFRSAGPGARADSGLRAFAPAVGSLLSEPAPAALAEEESPWICSDCGKTFGRRAAL
AKHQRYHAGERPHRCADCGKSFVYGSHLARHRRTHTGERPFPCPECGARFARGSHLAAHV
RGHTGEKPFVCGVCGAGFSRRAHLTAHGRAHTGERPYACAECGRRFGQSAALTRHQWAHA
EEKPHRCPDCGKGFGHSSDFKRHRRTHTGEKPFRCADCGRGFAQRSNLAKHRRGHTGERP
FPCPECGKRFSQRSVLVTHQRTHTGERPYLCSNCGRRFSQSSHLLTHMKTHRGQGGAPAQ
NTSAKAQAPAKAIPPLPPSGSGSGAGTLLEFAGGTSFGSDPAAFASPSGTYEESIL
Download sequence
Identical sequences D4A8C4
ENSRNOP00000037811 10116.ENSRNOP00000045973 NP_001100591.1.100692 NP_001100591.1.4139 XP_008767185.1.100692 XP_008767186.1.100692 XP_008767187.1.100692 XP_008767188.1.100692 XP_008767189.1.100692 XP_017453807.1.100692

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]