SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_008769277.1.100692 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_008769277.1.100692
Domain Number 1 Region: 2211-2304
Classification Level Classification E-value
Superfamily C-type lectin-like 3.77e-33
Family Link domain 0.0000947
Further Details:      
 
Domain Number 2 Region: 511-650
Classification Level Classification E-value
Superfamily FAS1 domain 3.66e-30
Family FAS1 domain 0.0017
Further Details:      
 
Domain Number 3 Region: 1716-1872
Classification Level Classification E-value
Superfamily FAS1 domain 6.93e-27
Family FAS1 domain 0.0054
Further Details:      
 
Domain Number 4 Region: 1476-1524,1602-1716
Classification Level Classification E-value
Superfamily FAS1 domain 1.26e-26
Family FAS1 domain 0.0025
Further Details:      
 
Domain Number 5 Region: 968-1125
Classification Level Classification E-value
Superfamily FAS1 domain 2.09e-23
Family FAS1 domain 0.006
Further Details:      
 
Domain Number 6 Region: 388-505
Classification Level Classification E-value
Superfamily FAS1 domain 2.49e-19
Family FAS1 domain 0.0074
Further Details:      
 
Domain Number 7 Region: 2302-2464
Classification Level Classification E-value
Superfamily FAS1 domain 7.46e-18
Family FAS1 domain 0.0088
Further Details:      
 
Domain Number 8 Region: 1134-1257
Classification Level Classification E-value
Superfamily FAS1 domain 0.000000549
Family FAS1 domain 0.0097
Further Details:      
 
Domain Number 9 Region: 1548-1585
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000795
Family Merozoite surface protein 1 (MSP-1) 0.047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_008769277.1.100692
Sequence length 2574
Comment PREDICTED: stabilin-1 isoform X3 [Rattus norvegicus]; AA=GCF_000001895.5; RF=representative genome; TAX=10116; STAX=10116; NAME=Rattus norvegicus; strain=mixed; AL=Chromosome; RT=Major
Sequence
MAEPRILLLLCILVLCLAGSGFIRGQTVRSKRCDIHTKFITHTPCTACAAIRRRLCPSGW
SRNFPEKILLDCRYELQLRGSVVSLSGCSQECWKDVVQKACCPGYWGSQCYECPGGPATP
CSGHGTCLDGIGGNGTCVCQENFSGSACQDCRDPNRFGPDCQSVCNCVHGVCSRGPQGNG
SCQCFAGYTGPHCDQELPVCQSLRCPQNSQCSAEAPACKCLPGYIQQDNACLREPLDPCQ
PSPCSSLARCSVTPSGQPQCHCPENYHGDGKVCLPQDPCLTNFGGCPSNSTFCLYRAPGK
ATCMCWPGMTSINNDASEGCHVSCKPHSCDKSATCQVTPDRKTSCVCKSDEVGDGYACYG
HLLHEVQRANQIGLVLLRLRVAIAMLEQGCQEILTTSGPFTVLVPSMFSVSAISSSNMNA
TLAQQLCRQHIIPGEHILENIGPSNTRRWWTLAGQEITVTFKNLRYSYKYEDQPQQFSIQ
KANYIAANGVFHTVTALRWQLPPPLPGDPKKTVGQILASTEAFTRFETILENCGLPAMLD
GPGPFTVFAPSNEAVDSLRDGRLIYLFTAGLSKLQELVRYHIYNHGQLTVEKLISKGRFL
TMANQVLTVNISEEGRILLGPEGVPVRRVDVPAANGVIHMLEGILLPPTILPILPKHCDE
EQHQTVLGSCVDCQALNTSICPPNSVKMDIFPKECVYTHDPAGLNVLKKGCAEYCNQTIT
KRGCCKGFFGPDCTQCPGGFSNPCYGKGNCSDGVQGNGACLCFPDYKGIACHICSNPNKH
GEQCQEDCGCVHGLCDNRPGSGGVCQQGTCAPGFQGRFCNESMGNCGSLGLAQPCHPDAH
CVIQEGVARCVCHDGFEGNGFSCKRSSPCSHPDRGGCSENAECVPGDLGTHQCICHKGWS
GDGRICVAIDECGLDTRGGCHADALCSYVGPGQSRCTCKLGFAGDGYECSPIDPCRVGNG
GCHGLATCKAVGGGQRVCTCPPHFGGDGFSCYGDIIQELEANAHFSAFSQWFKNSSITLP
ADGKLTALVPSESAIRRLRPEDQAFWLQPKTLPELVRAHFLQGAFSEEELARLSGQQVAT
LSATTHWQIHNTSGRVQVQNATVDVPDLLATNGVLHIISQVLLPPRGDMQTGPGLLQQLD
SVPAFRLFGEQLKHHKLVAQIEAAKAYTIFVPTNHSLETQGNKSILGIDIVRHHVILGEA
LSVEVLRKGGHRNSLLGPAHWLVFYNHSGQPEVNHVPLEGPLLEAPGSALFGLSGILAVG
SSRCLHSHAEALREKCVNCTRKFRCTQGFQLQDTPRKSCVYRSGLSFSRGCSYTCAKKIQ
VPDCCPGFFGTLCEPCPGGLGGVCSGHGQCQDRFLGNGECRCQEGFHGTACEMCELGRYG
PTCSGVCDCDHGLCQEGLRGNGSCICNVGWQGLRCDQKITDRQCPKKCDPNANCIQDSAG
IPVCVCAAGYSGNGSYCSEVDPCTSGHGGCSPYANCTKVAPGQRTCTCLDGYTGDGELCQ
EINSCLVHNGGCHVNAECIPTGPQQVSCNCREGYSGDGIQSCKLLDPCSQNNGGCSPYAV
CKSTGDGQRTCSCDSTHTVGDGITCHGRVGLELLRNKYASFFSLHLLEYKELKGDGPFTI
FVPHSDLISNMSQGELARMRAHRQLVFRYHVLGCRKLGSQELLDQGYVTALSGHTLRISE
REGSIYLNDFARVVSSDHEAVNGVLHFIDRVLLPPDVLHWEADTIPIPRRNVTAAAESFQ
YKIFSRLLTVAGLLPMLQDASHRPFTMLWPTDSALEALSPDRKNWLYHEDHRDKLAAILR
GHVIRNIEASASDLPNLGQLRTMHGNTISFSCGLARPGELMVGENEARIVQRYLLFEGGL
AYGIDQLLEPPDLGARCDRFEPQPLQTKTCSICGLEPPCPRGSREQGSPEACWRHYSKFW
ATPLHSITMRGGSWITPSFWNRNHMGRGCHRKCVTTVWKPSCCPGHYGADCHACPGGPRS
PCSGHGVCLDGISGSGQCNCHPGFAGTACELCAPGAFGPQCQACRCAPHGRCDEGLGGSG
SCFCDEGWTGPRCDVQLELQPVCTPPCAPQAVCRVGNSCECSLGYEGDGRVCTVADLCQK
GHGGCSKHANCSQVGTVVTCTCLPAYEGDGWSCRARNPCLDGHRGGCSEHADCFNTGPNT
RRCECHTGYVGDGLQCLEELEPPVDRCLAESSPCHTDALCTDLHFQEKQAGVFHIQATSG
PYGLTFSEAKEACEDQGADLASLPQLSAAQQLGFHVCFLGWLANGSAAHPVVTPAADCGN
NRVGVISLGVRKNLSERWDAYCYRVRDVACQCRVGFVGDGISTCNGKLLDVLAATADFST
FYGMLLGYANATQRGLDFMDFLEDELIYKTLFVPVNEGFLDNMTLSGPDLELHASNATFL
SANASQGTLLPAHSGLSLFISDTGPDNISLVPLAPGAVVVSHVMVWDIMAFNGVIHALAS
PLLTPPQPRAVLGSEPQPVALSLGVVITCGTLLGLVAGALYLRARRKAPGFSFSVFQAED
NADDDFSPWQEGTSPTLVSVPNPVFGSSDIFCEPFDDSVLEEDFPDTQRVLKVK
Download sequence
Identical sequences XP_006222187.1.4139 XP_008769277.1.100692

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]