SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_008770359.1.100692 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_008770359.1.100692
Domain Number 1 Region: 185-423
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 6.97e-49
Family Voltage-gated potassium channels 0.0014
Further Details:      
 
Domain Number 2 Region: 32-140
Classification Level Classification E-value
Superfamily POZ domain 3.92e-24
Family Tetramerization domain of potassium channels 0.00066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_008770359.1.100692
Sequence length 480
Comment PREDICTED: potassium voltage-gated channel subfamily G member 2 isoform X1 [Rattus norvegicus]; AA=GCF_000001895.5; RF=representative genome; TAX=10116; STAX=10116; NAME=Rattus norvegicus; strain=mixed; AL=Chromosome; RT=Major
Sequence
MARLPGHPEVPGAEPGSAVRGGRGGRGARARHVIINVGGCRVRLAWAALARCPLARLERL
RACRGHDELLRVCDDYDVSRDEFFFDRSPCAFRAIVALLRAGKLRLLRGPCALAFRDELA
YWGIDEARLERCCLRRLRRREEEAAEARATPPARGPQTSPGRALGSGRLERGRRRLRDVV
ENPHSGLAGKLFAYVSVAFVAVTAVGLCLSTMPDVRAEEERGECSTKCRNLFVLETVCVA
WFSFEFLLRSLQAESKCAFLRTPLAIIDILAILPFYVSLLAGLAAGPTGSKMLERAGLVL
RLLRALRVLYVMRLARHSLGLRSLGLTVRRCAREFGLLLLFLCVAMALFAPLVHLAEREL
GAHRDFSSVPASYWWAVISMTTVGYGDMVPRSLPGQVVALSSILSGILLMAFPVTSIFHT
FSRSYSELKEQQQRAASPEPVLREDSTRDDSTRSASATEDSSQDPETAGAAGSLPGPVGP
Download sequence
Identical sequences Q9QYU3
NP_001100842.1.100692 NP_001100842.1.4139 XP_006255009.1.100692 XP_006255010.1.100692 XP_006255012.1.100692 XP_008770358.1.100692 XP_008770359.1.100692 XP_017456433.1.100692 ENSRNOP00000023089

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]