SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_008771821.1.100692 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_008771821.1.100692
Domain Number 1 Region: 112-575
Classification Level Classification E-value
Superfamily Sema domain 1.44e-124
Family Sema domain 0.0000488
Further Details:      
 
Domain Number 2 Region: 1338-1467,1662-1851
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 3.53e-51
Family p120GAP domain-like 0.025
Further Details:      
 
Domain Number 3 Region: 924-1020
Classification Level Classification E-value
Superfamily E set domains 0.000000000000154
Family Other IPT/TIG domains 0.01
Further Details:      
 
Domain Number 4 Region: 1019-1108
Classification Level Classification E-value
Superfamily E set domains 0.00000000000224
Family Other IPT/TIG domains 0.05
Further Details:      
 
Domain Number 5 Region: 578-628
Classification Level Classification E-value
Superfamily Plexin repeat 0.000000000235
Family Plexin repeat 0.0024
Further Details:      
 
Domain Number 6 Region: 1106-1143,1174-1211
Classification Level Classification E-value
Superfamily E set domains 0.00000000117
Family E-set domains of sugar-utilizing enzymes 0.082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_008771821.1.100692
Sequence length 1881
Comment PREDICTED: plexin-A3 isoform X2 [Rattus norvegicus]; AA=GCF_000001895.5; RF=representative genome; TAX=10116; STAX=10116; NAME=Rattus norvegicus; strain=mixed; AL=Chromosome; RT=Major
Sequence
MACKLACACHSFICPIRGPSPLLASVTIWGSITLDELPCPCIALNLDCQGHWARQGRRRE
SRLGLGHLTPTCCLSSGLSLALQLLVMHTVCLLPLLFFTIGGCLGSSRPFRTFVVTDTTL
THLAVHRVTGEVFVGAVNRVFKLASNLTELRAHVTGPIEDNARCYPPPSMRVCSHRLVPV
DNVNKLLLIDYAARRLVACGSIWQGICQFLRLDDLFKLGEPHHRKEHYLSGAQEPDSMAG
VIVEQGQGPSKLFVGTAVDGKSEYFPTLSSRKLIDDEDSGDMFSLVYQDEFVSSQIKIPS
DTLSLYPAFDIYYIYGFVSASFVYFLTLQLDTQQTLLDTAGEKFFTSKIVRMCAGDSEFY
SYVEFPIGCSWRGVEYRLVQSAHLAKPGLLLAQALGVPADEDVLFTIFSQGQKNRANPPR
QTILCLFTLSSINAHIRRRIQSCYRGEGTLALPWLLNKELPCINTPMQINGNFCGLVLNQ
PLGGLHVIEGLPLLADSTDGMASVAAYTYHQHSVVFIGTRSGNLKKVRVDGSQDAQLYET
VSVVQGTPILRDLLFSPDHRHIYLLSEKQVSQLPVETCEQYLSCAACLGSGDPHCGWCVL
QHRCCREGACPGASAPHGFAEELNKCIQVRVRPNNVSVTSSGVQLTVAMRNVPDLSLGVS
CSFEEVTESEAILLPSGELRCPSPSLQELQTLTRGHGATHTVRLQLLSMETGVRFAGVDF
VFYNCSALQSCMSCVGSPYPCHWCKYRHVCTSHPHECSFQEGRVHSPEGCPEILPRGDLL
IPVGVMQPLTLRAKNLPQPQSGQKNYECVVRVQGRQHRVPAVRFNSSSVQCQNASYFYEG
DEFGDTELDFSVVWDGDFPIDKPPSFRALLYKCWAQRPSCGLCLKADPRFNCGWCISEHR
CQLRVHCPAPKSNWMHPSQKGARCSHPRITQIHPLTGPKEGGTRVTIVGENLGLTSREVG
LRVAGVRCNSIPTEYVSAERIVCEMEESLVPSPPPGPAELCVGDCSADFRTQSQQLYSFV
TPTLDRVSPTRGPASGGTRLTISGTSLDAGSRVTVIIRDGECQFVRRDAEAIVCISPIST
LGPSQAPIILAIDHANISSTGVIYTYTQDPTVTHLEPTWSIINGSTSITVSGTHLLTVQE
PRVRAKYRGIETTNTCQGKNLIPAAAGSSRLNYTVLIGGQPCALTVSDTQLLCDSPSQTG
RQPVMVLVGGLEFWLGTLHITADRALTLPAMVGLAAGGGLLLLAITVVLVAYKRKTQDAD
RTLKRLQLQMDNLESRVALECKEAFAELQTDINELTNHMDGVQIPFLDYRTYAVRVLFPG
IEAHPVLKELDTPPNVEKALRLFGQLLHSRAFLLTFIHTLEAQSSFSMRDRGTVASLTMV
ALQSRLDYATGLLKQLLADLIEKNLESKNHPKLLLRRTESVAEKMLTNWFTFLLHKFLKE
CAGEPLFLLYCAIKQQMEKGPIDAITGEARYSLSEDKLIRQQIDYKTLTLHCVCPESEGS
AQVPVKVLNCDSITQAKDKLLDTVYKGIPYSQRPKAEDMDLEWRQGRMARIILQDEDITT
KIECDWKRINSLAHYQVTDGSLVALVPKQVSAYNMANSFTFTRSLSRYESLLRAASSPDS
LRSRAPMLTPDQEAGTKLWHLVKNHDHADHREGDRGSKMVSEIYLTRLLATKGTLQKFVD
DLFETVFSTAHRGSALPLAIKYMFDFLDEQADQRQISDPDVRHTWKSNCLPLRFWVNVIK
NPQFVFDIHKNSITDACLSVVAQTFMDSCSTSEHRLGKDSPSNKLLYAKDIPNYKSWVER
YYRDIAKMASISDQDMDAYLVEQSRLHANDFNVLSALSELYFYVTKYRQEILTSLDRDAS
CRKHKLRQKLEQIITLVSSSS
Download sequence
Identical sequences XP_008771821.1.100692

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]