SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_008772138.1.4139 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_008772138.1.4139
Domain Number 1 Region: 196-253
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.18e-24
Family Classic zinc finger, C2H2 0.0062
Further Details:      
 
Domain Number 2 Region: 252-309
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.21e-24
Family Classic zinc finger, C2H2 0.0046
Further Details:      
 
Domain Number 3 Region: 476-533
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.4e-24
Family Classic zinc finger, C2H2 0.0047
Further Details:      
 
Domain Number 4 Region: 420-477
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.16e-23
Family Classic zinc finger, C2H2 0.0047
Further Details:      
 
Domain Number 5 Region: 364-421
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.58e-23
Family Classic zinc finger, C2H2 0.0051
Further Details:      
 
Domain Number 6 Region: 533-589
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.46e-23
Family Classic zinc finger, C2H2 0.0044
Further Details:      
 
Domain Number 7 Region: 308-365
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3e-23
Family Classic zinc finger, C2H2 0.0051
Further Details:      
 
Domain Number 8 Region: 589-645
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.62e-23
Family Classic zinc finger, C2H2 0.0047
Further Details:      
 
Domain Number 9 Region: 140-197
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.33e-23
Family Classic zinc finger, C2H2 0.0046
Further Details:      
 
Domain Number 10 Region: 644-701
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.03e-20
Family Classic zinc finger, C2H2 0.0073
Further Details:      
 
Domain Number 11 Region: 2-57
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 3.53e-20
Family KRAB domain (Kruppel-associated box) 0.00022
Further Details:      
 
Domain Number 12 Region: 88-141
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000188
Family Classic zinc finger, C2H2 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_008772138.1.4139
Sequence length 702
Comment PREDICTED: zinc finger protein 431-like isoform X4 [Rattus norvegicus]; AA=GCF_000002265.2; RF=na; TAX=10116; STAX=10116; NAME=Rattus norvegicus; strain=BN; Sprague-Dawley; AL=Chromosome; RT=Major
Sequence
MTVTYEDVHVNFTQEEWALLDPFQKKLYKDVMLETYKNLNAIGFNWEEKNIEEHCQSSRR
QRRHERSQSAEIPSEYTHCGKPFALHAHSHAQRNERIHSEKKPSEVIQCVEAFAPYTVLQ
LHKRTQARQKPYECSQCGKVFSNHSKLKKHESLHTEKKPYKCNECDKAFSQLSILYRHQR
VHTGEKPYKCNECDKAFSRHSRLKRHNRVHTGEKPYKCNECGKAFSLPSRLQMHNRVHTG
EKPYKCNECDKVFSIHSSLQRHKRVHTGEKPYKCNECDKAFSVHSRLKRHNRVHTGEKPY
KCNECDKAFSVHSRLKRHNRVHTGEKPYKCKECDKAFSEHDSLQTHKRVHTGEKPYKCNE
CDKAFSVHSSLQKHKRVHTGEKPYKCKECDKAFSEHDSLQTHKRVHTGEKPYKCNECDKA
FSVHSSLQKHKRVHTGEKPYKCNECDKAFSEHSSLQKHNRVHTGEKPYNCNECDKAFSDH
NSLRTHKRIHTGEKPYKCNECDKAFSVHSSLQKHQRVHTGEKPYKCNECDKDFSRHSHLQ
THKRVHTGEKPFKCNECDKAFSQHDILQKHKRVHTGEKPYKCNECDKDFSRHDILQKHKR
VHTGEKPYKCNECDKAFSVHSRLQKHKRVHTGEKPYKCNECDKAFSDHSSLRKHKKIHTG
EKPYKWNECDKTFLYHTSLQIHKRVHTGEKHYKCHECDKAFS
Download sequence
Identical sequences XP_008772138.1.4139

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]