SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_008816024.1.81653 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_008816024.1.81653
Domain Number 1 Region: 567-612
Classification Level Classification E-value
Superfamily RING/U-box 2.99e-16
Family RING finger domain, C3HC4 0.0071
Further Details:      
 
Domain Number 2 Region: 378-475
Classification Level Classification E-value
Superfamily Cdc48 domain 2-like 5.56e-16
Family Cdc48 domain 2-like 0.0017
Further Details:      
 
Weak hits

Sequence:  XP_008816024.1.81653
Domain Number - Region: 471-587
Classification Level Classification E-value
Superfamily F-box domain 0.0255
Family F-box domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_008816024.1.81653
Sequence length 614
Comment hypothetical protein C922_02203 [Plasmodium inui San Antonio 1]; AA=GCF_000524495.1; RF=representative genome; TAX=1237626; STAX=52288; NAME=Plasmodium inui San Antonio 1; strain=San Antonio 1; AL=Scaffold; RT=Major
Sequence
MESCRKGESKHMHFLSNVNSKKKLNIVEKKRILEKVHILPIKRRVENADSLYRKLQLLIN
DKCVLYEGFIIGANGEKERVPGGKNTRENLKEDVWETQKEGLTNDKGGRTKNENHTKNTD
LLERLSGAKEGPCPNEDSWEVADRKESDSHTERKNSSENCTEEDINKTPNNDQICLHEKC
TKDKLTDETSHFKESTDYYAVVNCIPSKGILTRDTLIYTDGKYVDNLKKIHLIIIRDKYY
KKYEKKLKKKFFSLKKYLLKKGNQFFNEAMSLIPFPFEHFWSNCTAEKGKRNSTFGGSIR
DTVTPHPTTIKRRSFVLEKILLTCLHPYFKKNRTKLFYSGKLLIINNFSFLVVKIDADVN
VGFVDNSTEIFLNADTYDPFRNVHIVPLYDTLPTTYNYDIFTDYIKPYIERHYLSLFSMH
DTFFYKGVQFKIMGIDPMNIKSGRGRITPNTFIYTDGAIKPTFFDVISNESINYIQCLPV
EYKPYAVLNILQQLDADSLLRLFPSTNANLQETALNEQRILSHLDKYKYVYRDNTRGDSQ
GGKMLLDVDMDEPIDGKNKSHNFAYEQCAVCFEYFENYDKCIKLACLHTYHWKCVKSWFR
FNLTCPCCRRELIL
Download sequence
Identical sequences W7A2P0
XP_008816024.1.81653

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]