SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_008827955.2.79516 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_008827955.2.79516
Domain Number 1 Region: 523-742
Classification Level Classification E-value
Superfamily Bet v1-like 1.03e-39
Family STAR domain 0.005
Further Details:      
 
Domain Number 2 Region: 121-242
Classification Level Classification E-value
Superfamily PH domain-like 4.11e-27
Family Pleckstrin-homology domain (PH domain) 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_008827955.2.79516
Sequence length 751
Comment PREDICTED: collagen type IV alpha-3-binding protein isoform X2 [Nannospalax galili]; AA=GCF_000622305.1; RF=representative genome; TAX=1026970; STAX=1026970; NAME=Nannospalax galili; AL=Scaffold; RT=Major
Sequence
MRRNGMSIPPSPLSAPPPSLPVVTREGWRGPSSGGGAGRSAGVTATAADGWKGRLPSPLV
LLPRSAPCQARRPRRGGRASSLFLYPHARDQALLAVPSPDPTPQGLGACTGAARGAGAGL
LLACRASMSDNQSWNSSGSEEDPETESGPPVERCGVLSKWTNYIHGWQDRWVVLKNNTLS
YYKSEDETEYGCRGSICLRKAVITPHDFDECRFDISVNDSVWYLRAQDPDHRQQWIDAIE
QHKTESGYGSESSLRRHGSMVSLVSGASGYSATSTSSFKKGHSLREKLAEMETFRDILCR
QVDTLQKYFDICADTVSKDELQRDKVVEDDEDDFPTTRSDGDFLHNTNGNKEKLFPHVTP
KGINGIDFKGEAITFKATTAGILATLSHCIELMVKREESWQKRHDKETDKRRRVEDAYKN
AMAELKKKSHFGGPDYEEGPNSLINEEEFFDAVEAALDRQDKIEEQSQSEKVRLHWPTSL
PSGDAFSSVGTHRFVQKPYSRSSSMSSIDLVSASDDVHRFSSQVEEVVQNHMTYSLQDVG
GDANWQLVVEEGEMKVYRREVEENGIVLDPLKATHAVKGVTGHEVCNYFWNVDVRNDWET
TVENFHVVETLADNAIIIYQTHKRVWPASQRDVLYLSAIRKIPALTENDPETWIVCNFSV
DHDSAPMNNRCVRAKINVAIICQTLVSPPEGNQEISRDNILCKITYVANVNPGGWAPASV
LRAVAKREYPKFLKRFTSYVQEKTAGKQILF
Download sequence
Identical sequences XP_008827955.2.79516

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]