SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_008841678.1.79516 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_008841678.1.79516
Domain Number 1 Region: 290-386
Classification Level Classification E-value
Superfamily Immunoglobulin 7.13e-20
Family I set domains 0.01
Further Details:      
 
Domain Number 2 Region: 408-740
Classification Level Classification E-value
Superfamily 3-carboxy-cis,cis-mucoante lactonizing enzyme 1.26e-16
Family 3-carboxy-cis,cis-mucoante lactonizing enzyme 0.042
Further Details:      
 
Domain Number 3 Region: 36-88
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.0000000000000108
Family Ovomucoid domain III-like 0.0094
Further Details:      
 
Domain Number 4 Region: 210-302
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000926
Family I set domains 0.047
Further Details:      
 
Domain Number 5 Region: 98-203
Classification Level Classification E-value
Superfamily EF-hand 0.00000000000484
Family Calmodulin-like 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_008841678.1.79516
Sequence length 802
Comment PREDICTED: follistatin-related protein 5 [Nannospalax galili]; AA=GCF_000622305.1; RF=representative genome; TAX=1026970; STAX=1026970; NAME=Nannospalax galili; AL=Scaffold; RT=Major
Sequence
MIYCSLSAEFLIQDGPFGSCENKYCGLGRHCAISRETGQAECACMDICKRHYKPVCGSDG
EFYENHCEVHRAACIKKQKITIVHNEDCFFKGDNCMTTEYSEMKNMLLDLQNQKYIMKEN
ENPNGDDISRKKLLVDQMFKYFDADSNGLVDINELTQVIKQQEHGKGLSDCTVYDLLKYD
DLNADKHLTLEEFYRAFQVIQLSLPEDQRLSVTAATVGQSAVLSCAIVGALRPPIIWKRN
NIVLNNLDLEDINDFGDDGSLYITKVTTVHMGNYTCYAEGYENIYQTHIFQVNVPPVIRV
YPESQAREPGVTASLRCHAEGIPDPQLGWLKNGIDITPKLSKQLTLQANGSEVHISNVRY
EDTGAYTCIARNEAGVDEDISSLFVEDSARKTLANILWREEGLGIGNMFYVFYEDGIKVI
QPIECEFQRHIKPSEKLLGFQDEVCPKAEDEEVQRCVWASAVNVKDKFIYVAQPTLDRIL
IVDVQSQKVVQAVSTDPVPVKLHYDKSHDQVWVLSWGSMEKTSPTLQVITLASGNVPHHT
IHTQPVGKQFDRVDDFFIPTTTLIITHMRFGFILHKEEAALHKIDLETMAYIKTISLKDA
KCVPQSLAYTHLGGYYFIGCKSDSTGAFPPQLVVDSVTDSIIGFNSDVTGTPYISPDGHY
LVSVNDVKGLVRIQYITIRGEILDAFDIHTNLHISDLAFQPSFTEAHQYNIYGSSSQQTD
VLFVELSSGKVKMIKSLKEPLKMEDWPWSQKNRHIQGSGLFGQYLMTPSKDSLFILDGRL
NKLNCEITEVQKGNTIIWVGDA
Download sequence
Identical sequences XP_008841678.1.79516

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]