SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_008853143.1.79516 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_008853143.1.79516
Domain Number 1 Region: 51-546
Classification Level Classification E-value
Superfamily Sema domain 4.45e-100
Family Sema domain 0.0011
Further Details:      
 
Domain Number 2 Region: 1410-1535,1701-1853
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 7.69e-33
Family p120GAP domain-like 0.023
Further Details:      
 
Domain Number 3 Region: 887-978
Classification Level Classification E-value
Superfamily E set domains 0.00000000000014
Family Other IPT/TIG domains 0.016
Further Details:      
 
Domain Number 4 Region: 978-1068
Classification Level Classification E-value
Superfamily E set domains 0.00000000000028
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.053
Further Details:      
 
Domain Number 5 Region: 1065-1146
Classification Level Classification E-value
Superfamily E set domains 0.0000000000175
Family E-set domains of sugar-utilizing enzymes 0.079
Further Details:      
 
Domain Number 6 Region: 549-600
Classification Level Classification E-value
Superfamily Plexin repeat 0.00000000012
Family Plexin repeat 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_008853143.1.79516
Sequence length 1925
Comment PREDICTED: plexin-D1 [Nannospalax galili]; AA=GCF_000622305.1; RF=representative genome; TAX=1026970; STAX=1026970; NAME=Nannospalax galili; AL=Scaffold; RT=Major
Sequence
MARSARATAAIPLQPRSCSRGPGLSLPPPPPPLLLLLLLLGPARAGALEIQRRFPSPTPT
NNFALDGAAGTVYLAAVNRLYQLSGANLSLEAEAAVGPVPDSPLCHAPQLPQASCEHPRR
LTDNYNKILQLDPGQGLVVVCGSIYQGFCQLRRRGNISAVAVRFPPAAPPAEPVTVFPSM
LNVAANHPNASTVGLVLPPAAGARGSRLLVGATYTGYGSAFFPRNRSLEDHRFENTPEIA
IRSLDARGDLAKLFTFDLNPSDDNILKIKQGAKEQHKLGFVRAFLHPEPPRGAQPYAYLA
LNSEARAGDKDSQARSLLARICLPRGAGGDAKKLTESYIQLGLQCAGGAGRGDLYSRLVS
VFPTRDLLFAVFERPQGSPAARAAPAALCAFRFADVQGAIRAARTACFVEPAPDVVAVLD
SVVQGTGPACESKRNIQLQMEQLDCGAAHLQHPLSILQPLRASPVFRAPGLTAVAVANAN
NYTAVFLGTSTGRLLKISLNESMQVVSRRVLTVAYGEPVHHVMEFDPTDPGYLYLMTSYQ
MARVKVAACEVHPTCGDCVGAADAYCGWCALETRCTLQQDCANSSQPHFWTSASEGPGRC
PAMAVLPAEIDVHQDYPGMILQISGSLPSLSGMEMTCDYGNDVRTVARVPGPAYDHQITY
CNLLPRDQFPPFPVDQDHVTVEMSVRVKGHNIVSANFTIYNCSRIGQVYPHTACTSCLSA
QWPCFWCTQQHACISNQSRCEASPNPMKPQDCPQILPSPLAPVPTGGSQDILVPLTSATL
FHGTSLECSFGLEESFEAVWVNESLVRCNQVVLHTAQKSQVFQLSLQLKGQRDRFLDSPD
PMTVVVYNCAMGSPDCSQCLGREDLGHLCAWIDGCRLRGPLQPPPGTCPAPEIRAIEPLS
GPLDGGTLLTIRGRNLGRRLSDVAQGVWIGSVACEPLANRYTVSEEIVCATGPAPGAFSD
VVTVNASKEGKSRDRFSYVMPVVHSLEPPMGPKAGGTRITIHGSDLHVGSELQVLVNDTD
PCTELVRTAMSITCTVPGGTSPSLVPVCVRFERQNCVHGNLTFQYMQNPVITAISPGRSP
VSGGRTITVAGERFHMVQNVSMAVHHIGREPTLCKVLNSTLITCPSPGALSNASAPVDFF
INGRAYADEAVVAEELLDPLEAQRGSRFRLDYLPNPQFSTAKREKWIKHHPGEPLTLVIH
KEQDSLGLESHEYHIKIGQVACDIQIVSDRVIHCSVNESLGRAEGQLPITIQVGNFNQTI
ATLQLGGSEPAIVVSIVICSVLLLLSVVALFVFCTKSRRAERYWQKTLLQMEEMESQIRE
EIRKGFAELQTDMTDLTKELNRSQGIPFLEYKHFVTRTFFPKCSSLYEERYVLPSQTLNS
QGGSPPQETHPLLGEWNIPEHCRPNMEEGISLFSSLLNNKHFLIVFVHALEQQKDFAVRD
RCSLASLLTIALHGKLEYYTSIMKELLVDLIDASAAKNPKLMLRRTESVVEKMLTNWMSI
CMYGCLRETVGEPFFLLLCAIKQQINKGSIDAITGKARYTLNEEWLLRENIEAKPRNLNV
SFQGCGMDSLSVRAMDTDTLTQVKEKILEAFCKNVPYSQWPRAEDVDLEWFASSTQSFVL
RDLDDTSVVEDGRKKLNTLAHYKIPEGASLAMSLSDKKDNTLGRVKDLDTEKYFHLVLPT
DELAEPKKSHRQSHRKKVLPEIYLTRLLSTKGTLQKFLDDLFKAILSIREDKPPLAVKYF
FDFLEEQAEKRGISDSDTLHIWKTNSLPLRFWVNILKNPQFVFDIEKTDHIDACLSVIAQ
AFIDACSISDLQLGKDSPTNKLLYAKEIPEYRKIVQRYYKQIQDMTPLSEQEMNAHLAEE
SRKYQNEFNTNVAMTEIYKYAKRYRPQIMAALEANPTARRTQLQHKFEQVVALMENNIYE
CYSEA
Download sequence
Identical sequences XP_008853143.1.79516

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]