SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_008866227.1.42657 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_008866227.1.42657
Domain Number 1 Region: 246-469
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.19e-68
Family Protein kinases, catalytic subunit 0.00000294
Further Details:      
 
Domain Number 2 Region: 42-124,219-250
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 0.0000000000000471
Family Regulator of G-protein signaling, RGS 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_008866227.1.42657
Sequence length 493
Comment AGC/GRK/BARK protein kinase, variant 2 [Aphanomyces invadans]; AA=GCF_000520115.1; RF=representative genome; TAX=157072; STAX=157072; NAME=Aphanomyces invadans; strain=NJM9701; AL=Scaffold; RT=Major
Sequence
MDELQDAIQDAQYIGAMADPRPRPTVPFHQPSPQELTEFTENVASHHWPTMESYLSQPLG
LYLFRRYCEAEAHGIEKLCFLQDVYAYRRIPQHNRRVLKAKAIYATYIHPQTATTLSSTD
PPTAPPTTTSPGVGAAPSATIALKTHPLLASTKNPGDTNYAWKQESSISMTTARELYCTF
KCEAALLGVRGDLTEDIGKQLEDANLLSGSATSTLPLTLFDELEACVVSALEHHQMEGFK
ASAFFKRFMHFLLIQQREIGEDDFSLLRVLGRGGFGMVNGAIKRSTGKLYAMKAMNKRII
KKKHAEKLCLAERAILTMLSSPFVVCLKYAFQTKEDLFLVLDLRTGGDLSFHLNRGRFTE
EQVMYWSAQILLGLQHLHEKNIVYRDLKPENILLDDKGNCSISDLGLAVEVTPSLCGRCG
TRGYWAPEMLLRDEAGNRLCYNQTVDWWSYGCVVYEMLYGKCPFRTSKAKALHADKVPIS
LSQRWRLRGISNR
Download sequence
Identical sequences A0A024UF00
XP_008866227.1.42657

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]