SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_008928052.1.96775 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_008928052.1.96775
Domain Number 1 Region: 76-218
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 1.91e-39
Family Regulator of G-protein signaling, RGS 0.000000195
Further Details:      
 
Domain Number 2 Region: 760-841
Classification Level Classification E-value
Superfamily Ubiquitin-like 3.82e-27
Family DIX domain 0.0000136
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_008928052.1.96775
Sequence length 841
Comment PREDICTED: axin-1 [Manacus vitellinus]; AA=GCF_000692015.1; RF=na; TAX=328815; STAX=328815; NAME=Manacus vitellinus; AL=Scaffold; RT=Major
Sequence
MNIQGKGFPLDLGGSFTEDAPRPPVPGEEGELVSTDPRPVSHGFYSGKSDVVRNEMSTAT
PRRSDLDLGYEPEGSASPTPPYLKWAESLHSLLDDQDGINLFRTFLKQEDCADLLDFWFA
CSGFRKLEPCVSNEEKRLKLAKAIYKKYILDNNGIVSRQIKPATKSFIKDCVVKLQIDPD
MFDQAQTEIQCMIEDNTYPLFLKSDIYLEYTRTGGESPKIYSDPSSGSGTGKGLPGYLPT
LNEDEEWKCDQEAKPEASRDSAPSSRLTQKLLLETATQRAASARRYSEGREFRHGSWREP
VNPYYVNTGYALAPATSANDSEQQSMSSDADTMSLTDSSVDGIPPYRLRKQHRREMQESA
KANGRVPLPHIPRTYRMPKDIHVEPEKFAAELINRLEEVQKEREAEEKLEERLKRVRAEE
EGEDADISSGPSVISHKMPSAQAFHHFAPRYAEMGCAGVQMRDAHEENPESILDEHVQRV
MKTPGCQSPGPGRHSPKPRSPESGHLGKVSGTLGTIPPGHGKHATKSGMKQDAANLYHHK
HVYHHIHHHSMMKPKEQIEAEATQRVQNSFAWNVDSHNYATKSRNYSENLGMAPVPMDSL
GYSGKASLLSKRNVKKTDSGKSDGANYEMPGSPEDVERNQKILQWIIEGEKEISRHKKTN
HGSSGAKKQLSHDMVRPLSIERPVAVHPWVSAQLRNVVQPSHPFIQDPTMPPNPAPNPLT
QLEEARRRLEEEEKRAGKLPLKQRLKPQKRPGSGASQPCENIVVAYYFCGEPIPYRTLVK
GRVVTLGQFKELLTKKGNYRYYFKKVSDEFDCGVVFEEVREDDTILPIFEEKIIGKVEKI
D
Download sequence
Identical sequences A0A093PEG4
XP_008928052.1.96775

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]