SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_008941003.1.37566 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_008941003.1.37566
Domain Number 1 Region: 344-481
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.91e-25
Family UBX domain 0.0098
Further Details:      
 
Domain Number 2 Region: 115-207
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.000000366
Family Thioltransferase 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_008941003.1.37566
Sequence length 596
Comment PREDICTED: UBX domain-containing protein 4 [Merops nubicus]; AA=GCF_000691845.1; RF=representative genome; TAX=57421; STAX=57421; NAME=Merops nubicus; AL=Scaffold; RT=Major
Sequence
MVKQAVPLQLMEVNSGVDIYLEDPMLEEREAPGEGCDSVGSLHWSRPLAGPVNLWTERSP
CWSRLAGSIGDPVEGAHAGPVCEELQHMGRTHAGEVLGRLSPVRGTPHWSRGRVVLYLAG
EDEQSTEMAARWEDEKVTEAASDGFVAIKIDTKSEACLQFSQIYPVVCVPSSFFIGDNGI
PLEVIAGSVSVEELVTRIHKVKQMHTVKGQPLENGSQSSAPCPSSQSDGAPENTQSRAVE
FCDSPVLSETRPADGTNSGPASQEATNSLAGQVSDAQPANDLTLKVERITKKLEERREEK
RKEEEQKEIKKEIERRKTGKEMLEYKRRQEEELTKRMLEERSREKAEEKATRERIRQQIA
MDRAERAARFAKSKEEEAAKAAALQAKQAEIEARKEASLKERSAIARIQFRLPDGSSFTN
QFPSEARLEEARQYAAQTVGNAYGNFSLATMFPRREFTKEDYGKKLLELELAPSASVVLL
PAGRPGTSVVQASGSDLWKFLGTILYPLLAVWRFISNFLFTSPPPSQAAVRSAHQQDHAT
PPASSSTETSRQAVRKRVVEKRGEDFKKEGKIYRLRTQDDGEDENNTWNGNSTQQM
Download sequence
Identical sequences XP_008941003.1.37566

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]