SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_008953908.1.60992 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_008953908.1.60992
Domain Number 1 Region: 40-199
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.000000461
Family SMI1/KNR4-like 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_008953908.1.60992
Sequence length 304
Comment PREDICTED: tubulin polyglutamylase complex subunit 2 isoform X4 [Pan paniscus]; AA=GCF_000258655.2; RF=representative genome; TAX=9597; STAX=9597; NAME=Pan paniscus; AL=Chromosome; RT=Major
Sequence
MEEEASSPGLGCSKPHLEKLTLGITRILESSPGVTEVTIIEKPPAERHMISSWEQKNNCV
MPEDVKNFYLMTNGFHMTWSVKLDEHIIPLGSMAINSISKLTQLTQSSMYSLPNAPTLAD
LEDDTHEASDDQPEKPHFDSRSVIFELDSCNGSGKVCLVYKSGKPALAEDTEIWFLDRAL
YWHFLTDTFTAYYRLLITHLGLPQWQYAFTSYGISPQAKITYNIKMNRRKCVHWKLAVEP
LQWELRSCVSAGMGTGHKQRVSSMKPRSCSVCSRRQSNSMGTTVSQSFLSYGKNVLFFTV
RCCF
Download sequence
Identical sequences NP_001258880.1.87134 NP_001258880.1.92137 XP_008953908.1.60992 ENSP00000464780 ENSP00000465987 ENSP00000464780

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]