SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_008955970.1.60992 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_008955970.1.60992
Domain Number 1 Region: 64-110
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000000544
Family EGF-type module 0.00013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_008955970.1.60992
Sequence length 178
Comment PREDICTED: probetacellulin [Pan paniscus]; AA=GCF_000258655.2; RF=representative genome; TAX=9597; STAX=9597; NAME=Pan paniscus; AL=Chromosome; RT=Major
Sequence
MDRAARGSGASSLPLLLALALGLVILHCVVADGNSTRSPETNGLLCGDPEENCAATTTQS
KRKGHFSRCPKQYKHYCIKGRCRFVVAEQTPSCVCDEGYIGARCERVDLFYLRGDRGQIL
VICLIAVMVVFIILVIGVCTCCHPLRKRHKRKKKEEEMETLDKDITPVNEDIEETNIA
Download sequence
Identical sequences H2QPP5
9598.ENSPTRP00000027785 XP_008955970.1.60992 XP_009446008.1.37143 ENSPTRP00000027785 ENSPTRP00000027785

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]