SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_008958592.1.60992 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_008958592.1.60992
Domain Number 1 Region: 180-194,283-323,378-591
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 5.37e-59
Family Nuclear receptor ligand-binding domain 0.0000955
Further Details:      
 
Domain Number 2 Region: 112-193
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 1.53e-29
Family Nuclear receptor 0.0000936
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_008958592.1.60992
Sequence length 604
Comment PREDICTED: nuclear receptor subfamily 2 group C member 1 isoform X1 [Pan paniscus]; AA=GCF_000258655.2; RF=representative genome; TAX=9597; STAX=9597; NAME=Pan paniscus; AL=Chromosome; RT=Major
Sequence
MATIEEIAHQIIEQQMGEIVTEQQTGQKIQIVTALDRTTQGKQFILTNHDGSTPSKVILA
RQDSTPGKVFLTTPDAAGVNQLFFTTPDLSAQHMQLLTDNSSPDQGPNKVFDLCVVCGDK
ASGRHYGAVTCEGCKGFFKRSIRKNLVYACRGSKDCIINKHHRNRCQYCRLQRCIAFGMK
QDSVQCERKPIEVSREKSSNCAASTEKIYIRKDLRSPLTATPTFVADSESTRSTGLLDSG
MFVNIHPSGVKTESTVLMTSDKAESCQGDLSTLASVVTSLANLGKTKDLSQNSNEMSMIE
SLSNDDTSLCEFQEMQTNGDVSRAFDTLAKALNPGESTACQSSVAGMEGSVHLITGDSSI
NYTEKEGPLLSDSHVAFRLTMPSPMPEYLNVHYIGESASRLLFLSMHWALSIPSFQALGQ
ENSISLVKAYWNELFTLGLAQCWQVMNVATILATFVNCLHNSLQQDKMSTERRKLLMEHI
FKLQEFCNSMVKLCIDGYEYAYLKAIVLFSPDHPGLENMEQIEKFQEKAYVEFQDYITKT
YPDDTYRLSRLLLRLPALRLMNATITEELFFKGLIGNIRIDSVIPHILKMEPADYNSQII
GHSI
Download sequence
Identical sequences H2Q6M4
ENSPTRP00000009017 XP_008958592.1.60992 9598.ENSPTRP00000009017 ENSPTRP00000009017

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]