SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_008959770.1.60992 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_008959770.1.60992
Domain Number 1 Region: 46-138
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 1.24e-38
Family SCAN domain 0.0000629
Further Details:      
 
Domain Number 2 Region: 642-699
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.82e-27
Family Classic zinc finger, C2H2 0.0041
Further Details:      
 
Domain Number 3 Region: 586-643
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.76e-24
Family Classic zinc finger, C2H2 0.0036
Further Details:      
 
Domain Number 4 Region: 474-531
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.16e-24
Family Classic zinc finger, C2H2 0.0051
Further Details:      
 
Domain Number 5 Region: 530-587
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.04e-24
Family Classic zinc finger, C2H2 0.0031
Further Details:      
 
Domain Number 6 Region: 418-475
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.07e-23
Family Classic zinc finger, C2H2 0.0037
Further Details:      
 
Domain Number 7 Region: 684-736
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.71e-21
Family Classic zinc finger, C2H2 0.0035
Further Details:      
 
Domain Number 8 Region: 380-432
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.61e-20
Family Classic zinc finger, C2H2 0.0056
Further Details:      
 
Domain Number 9 Region: 223-284
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 0.0000000000615
Family KRAB domain (Kruppel-associated box) 0.0048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_008959770.1.60992
Sequence length 753
Comment PREDICTED: zinc finger protein with KRAB and SCAN domains 7 isoform X1 [Pan paniscus]; AA=GCF_000258655.2; RF=representative genome; TAX=9597; STAX=9597; NAME=Pan paniscus; AL=Chromosome; RT=Major
Sequence
MTTAGRGNLGLIPRSTAFQKQEGRLTVKQEPANQTWGQGSSLQKNYPPVCEIFRLHFRQL
CYHEMSGPQEALSRLRELCRWWLMPEVHTKEQILELLVLEQFLSILPGELRTWVQLHHPE
SGEEAVAVVEDFQRHLSGPEEVSAPAQKQEMHFEETTALGTTKESPTSPLSGGSAPGAHL
EPPYDPGTHHLPNGDFAQCTSPVPTLPQVGNSGDQAGATVLRMVRPQDTVAYEDLSVDYT
QKKWKGLTLSQRALQWNMMPENHHSMASLAGENMMKGSELTPKQEIFKGSESSNRTSGGL
FGVVPGAAETGDVCEDTLKELEGQTSDEEGSRLENDFLEITDEDKKKSTKDRYDKYKEVG
EHPPLSSSPVEHEGVLKGQKSYRCDECGKAFNRSSHLIGHQRIHTGEKPYECNECGKTFR
QTSQLIVHLRTHTGEKPYECSECGKAYRHSSHLIQHQRLHNGEKPYKCNECAKAFTQSSR
LIDHQRTHTGEKPYECNECGEAFIRSKSLARHQVLHTGKKPYKCNECGRAFCSNRNLIDH
QRIHTGEKPYECSECGKAFSRSKCLIRHQSLHTGEKPYKCSECGKAFNQNSQLIEHERIH
TGEKPFECSECGKAFGLSKCLIRHQRLHTGEKPYKCNECGKSFNQNSHLIIHQRIHTGEK
PYECNECGKVFSYSSSLMVHQRTHTGEKPYKCNDCGKAFSDSSQLIVHQRVHTGEKPYEC
SECGKAFSQRSTFNHHQRTHTGEKSSGLAWSVS
Download sequence
Identical sequences H2QME7
XP_008959770.1.60992 XP_008959771.1.60992 XP_016796349.1.37143 XP_016796350.1.37143 ENSPTRP00000025555 9598.ENSPTRP00000025555 ENSPTRP00000025555

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]