SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_008961122.1.60992 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_008961122.1.60992
Domain Number 1 Region: 478-591
Classification Level Classification E-value
Superfamily SH2 domain 6.46e-31
Family SH2 domain 0.000000631
Further Details:      
 
Domain Number 2 Region: 163-256
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.45e-28
Family Ras-binding domain, RBD 0.00019
Further Details:      
 
Domain Number 3 Region: 283-414
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000000000112
Family Pleckstrin-homology domain (PH domain) 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_008961122.1.60992
Sequence length 594
Comment PREDICTED: growth factor receptor-bound protein 10 isoform X1 [Pan paniscus]; AA=GCF_000258655.2; RF=representative genome; TAX=9597; STAX=9597; NAME=Pan paniscus; AL=Chromosome; RT=Major
Sequence
MALAGCPDSFLHHPYYQDKVEQTPRSQQDPAGPGLPAQSDRLANHQEDDVDLEALVNDMN
ASLESLYSACSMQSDTVPLLQNGQHARSQPRASGPPRSVQPQVSPRQRVQRSQPVHILAV
RRLQEEDQQFRTSSLPAIPNPFPELCGPGSPPVLTPGSLPPSQAAAKQDVKVFSEDGTSK
VVEILADMTARDLCQLLVYKSHCVDDNSWTLVEHHPHLGLERCLEDHELVVQVESTMASE
SKFLFRKNYAKYEFFKNPMNFFPEQMVTWCQQSNGSQTQLLQNFLNSSSCPEIQGFLHVK
ELGKKSWKKLYVCLRRSGLYCSTKGTSKEPRHLQLLADLEDSNIFSLIAGRKQYNAPTDH
GLCIKPNKVRNETKELRLLCAEDEQTRTCWMTAFRLLKYGMLLYQNYRIPQQRKALLSPF
STPVRSVSENSLVAMDFSGQTGRVIENPAEAQSAALEEGHAWRKRSTRMNILGSQSPLHP
STLSTVIHRTQHWFHGRISREESHRIIKQQGLVDGLFLLRDSQSNPKAFVLTLCHHQKIK
NFQILPCEDDGQTFFSLDDGNTKFSDLIQLVDFYQLNKGVLPCKLKHHCIRVAL
Download sequence
Identical sequences A0A2I3G1F1 G3QUE8
XP_008961122.1.60992 XP_008961123.1.60992 XP_008961124.1.60992 XP_014201144.1.60992 XP_018886928.1.27298 XP_018886929.1.27298 XP_018886931.1.27298 ENSNLEP00000010190 ENSGGOP00000006350 ENSPTRP00000059240 ENSPTRP00000059240 ENSNLEP00000010190 ENSGGOP00000006350

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]