SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_008962414.1.60992 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_008962414.1.60992
Domain Number 1 Region: 284-709
Classification Level Classification E-value
Superfamily Sema domain 1.16e-100
Family Sema domain 0.00031
Further Details:      
 
Domain Number 2 Region: 1605-1731,1926-2077
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 9.42e-40
Family p120GAP domain-like 0.045
Further Details:      
 
Domain Number 3 Region: 1162-1251
Classification Level Classification E-value
Superfamily E set domains 0.00000000000000443
Family Other IPT/TIG domains 0.022
Further Details:      
 
Domain Number 4 Region: 1070-1165
Classification Level Classification E-value
Superfamily E set domains 0.0000000000000864
Family Other IPT/TIG domains 0.014
Further Details:      
 
Domain Number 5 Region: 712-764
Classification Level Classification E-value
Superfamily Plexin repeat 0.0000000000131
Family Plexin repeat 0.002
Further Details:      
 
Domain Number 6 Region: 1250-1294,1332-1385
Classification Level Classification E-value
Superfamily E set domains 0.000000458
Family Quinohemoprotein amine dehydrogenase A chain, domains 4 and 5 0.06
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_008962414.1.60992
Sequence length 2145
Comment PREDICTED: plexin-B3 isoform X2 [Pan paniscus]; AA=GCF_000258655.2; RF=representative genome; TAX=9597; STAX=9597; NAME=Pan paniscus; AL=Chromosome; RT=Major
Sequence
MCHAAQEIPLLHHFMHPRCLAPVLPRPGAGRQHGAHPCLFADLLLAQPAAAWLFPPAAEG
SSLQPALAAQGRFSLPVWSLGAHGGLTPLTPLRSLLSGWRAQGRAVTQLPPAFQLPRPPS
LPCPLSIPAPSVTHSPSVSALVAFQDLPPFNNLHAYKVGDERILSLCACACAHAPLPASC
SSSWTLSLSLLMSPSLCAPSVSLSPLTLSHSPSLCLPPSLALSTLASVHPTFHLPLVLYL
PCAPTALTCALSQAPVMARWPPFGLCLLLLLLSPPPLPLTGAHRFSAPNTTLNHLALAPG
RGTLYVGAVNRLFQLSPELQLEAVAVTGPVIDSPDCVPFRDPAECPQAQLTDNANQLLLV
SSRAQELVACGQVRQGVCETRRLGDVAEVLYQAEDPGDGQFVAANTPGVATVGLVVPLPG
RDLLLVARGLAGKLSAGVPPLAIRQLAGSQPFSSEGLGRLVVGDFSDYNNSYVGAFADAR
SAYFVFRRRGARAQAEYRSYVARVCLGDTNLYSYVEVPLACQGQGLIQAAFLAPGTLLGV
FAAGPRGTQAALCAFPMVELGASMEQARRLCYTAGGRGPSGAEEATVEYGVTSRCVTLPL
DSPESYPCGDEHTPSPIAGRQPLEVQPLLKLGQPVSAVAALQADGHMIAFLGDTQGQLHK
VFLHGSQGQVYHSQQVGPPGSAISPDLLLDSSGSHLYVLTAHQVDRIPVAACPQFPDCAS
CLQAQDPLCGWCVLQGRCTRKGQCGRAGQLNQWLWSYEEDSHCLHIQSLLPGHHPRQEQG
QVTLSVPRLPILDADEYFHCAFGDYDSLAHVEGPHVACVTPPQDQVPLNPPGTDHVTVPL
ALMFEDVTVAATNFSFYDCSAVQALEAAAPCRACVGSIWRCHWCPQSSHCVYGEHCPEGE
RTIYSAQEVDIQVRGPGACPQVEGLAGPHLVPVGWESHLALRVRNLQHFRGLPASFHCWL
ELPGELRGLPATLEETAGDSGLIHCQAHQFYPSMSQRELPVPIYVTQGEAQRLDNTHALY
VILYDCAMGHPDCSHCQAANRSLGCLWCADGQPACRYGPLCPPGAVELLCPAPSIDAVEP
LTGPPEGGLALTILGSNLGRAFADVQYAVSVASRPCNPEPSLYRTSARIVCVTSPAPNGT
TGPVRVAIKSQPPGISSQHFTYQDPVLLSLSPRWGPQAGGTQLTIRGQHLQTGGNTSAFV
GGQPCPILEPVCPEAIVCRTRPQAVPGEAAVLVVFGHAQRTLLASPFRYTANPRLVAAEP
SASFRGGGRLIRVRGTGLDVVQRPLLSVWLEADAEVQASRAQPQDPQPRRSCGAPAADPQ
ACIQLGGGLLQCSTVCSVNSSSLLLCRSPAVPDRARPQRVFFTLDNVQVDFASASGGQGF
LYQPNPRLAPLSREGPARPYRLKPGHVLDVEGEGLNLGISKEEVRVHIGRGECLVKTLTR
THLYCEPPAHAPQPANGSGLPQFVMGNVQLALGPVQYEAEPPLSAFPVEAQAGVGMGAAV
LIAAVLLLTLMYRHKSKQALRDYQKVLVQLESLETGVGDQCRKEFTDLMTEMTDLSSDLE
GSGIPFLDYRTYAERAFFPGHGGCPLQPKPEGPGEDGHCATVRQGLTQLSNLLNSKLFLL
TLIHTLEEQPSFSQRDRCHVASLLSLALHGKLEYLTDIMRTLLGDLAAHYVHRNPKLMLR
RTETMVEKLLTNWLSICLYAFLREVAGEPLYMLFRAIQYQVDKGPVDAVTGKAKRTLNDS
RLLREDVEFQPLTLMVLVGPGAGGAAGSSETQRVPARVLDTDTITQVKEKVLDQVYKGTP
FSQRPSVHALDLEWRSGLAGHLTLSDEDLTSVTQNHWKRLNTLQHYKVPDGATVGLVPQL
HRGSTISQSLAQRCPLGENIPTLEDGEEGGVCLWHLVKATEEPEGAKVRCSSLREREPAR
AKAIPEIYLTRLLSMKGTLQKFVDDTFQAILSVNRPIPIAVKYLFDLLDELAEKHGIEDP
GTLHIWKTNSLLLRFWVNALKNPQLIFDVRVSDNVDAILAVIAQTFIDSCTTSEHKVGRD
SPVNKLLYAREIPRYKQMVERYYADIRQSSPASYQEMNSALAELSGNYTSAPHCLEALQE
LYNHIHRYYDQIISALEEDPVGQKLQLACRLQQVAALVENKVTDL
Download sequence
Identical sequences XP_008962414.1.60992

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]