SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_008968032.1.60992 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_008968032.1.60992
Domain Number 1 Region: 401-458
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.32e-23
Family Classic zinc finger, C2H2 0.0042
Further Details:      
 
Domain Number 2 Region: 569-626
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.97e-23
Family Classic zinc finger, C2H2 0.0038
Further Details:      
 
Domain Number 3 Region: 289-346
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.43e-23
Family Classic zinc finger, C2H2 0.0051
Further Details:      
 
Domain Number 4 Region: 233-290
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.3e-23
Family Classic zinc finger, C2H2 0.0045
Further Details:      
 
Domain Number 5 Region: 514-570
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.11e-22
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 6 Region: 611-663
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.44e-20
Family Classic zinc finger, C2H2 0.0042
Further Details:      
 
Domain Number 7 Region: 10-69
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.57e-20
Family KRAB domain (Kruppel-associated box) 0.0017
Further Details:      
 
Domain Number 8 Region: 457-514
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.05e-20
Family Classic zinc finger, C2H2 0.0084
Further Details:      
 
Domain Number 9 Region: 345-402
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.47e-20
Family Classic zinc finger, C2H2 0.007
Further Details:      
 
Domain Number 10 Region: 177-234
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.62e-19
Family Classic zinc finger, C2H2 0.0073
Further Details:      
 
Domain Number 11 Region: 122-178
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.83e-16
Family Classic zinc finger, C2H2 0.0083
Further Details:      
 
Domain Number 12 Region: 84-136
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000341
Family Classic zinc finger, C2H2 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_008968032.1.60992
Sequence length 672
Comment PREDICTED: LOW QUALITY PROTEIN: putative uncharacterized zinc finger protein 814 [Pan paniscus]; AA=GCF_000258655.2; RF=representative genome; TAX=9597; STAX=9597; NAME=Pan paniscus; AL=Chromosome; RT=Major
Sequence
MAAAATLRLSAQGTVTFEDVAVNFTWEEWNLLSEAQRCLYRDVTLENLALISSLGCWCGV
EDEAAPSKQSIYIQRETQRVHTEKKHECGECGKSFSKYVSFSNHQRVHTEKKNYECGECG
KSFSKYVSFSNHQRVHTGKRPYECGECGKSFSKYASFSNHQRVHTDKXHECGECGKSFSK
YVSFSNHQRVHTGKRPYECGECGKSFSKYASFSNHQRVHTDKKHYECGECGKSFSQKSSL
IQHQRFHTGEKPYGCEECGKSFSSEGHLRSHQRVHAGERPFKCGECVKSFSHKRSLVHHQ
RVHSGARPYQCGECGKSFSQKGNLVLHQRVHTGARPYECGECGKSFSSKGHLRNHQQIHT
GDRLYECGECGKSFSHKGTLILHQRVHPRERSYGCGECGKSFSSIGHLRSHQRVHTGERP
YECGECGKSFSHKRSLVHHQRMHTGERPYKCGDCGKSFNEKGHLRNHQRVHTTERPFKCG
ECGKCFSHKGNLILHQHGHTGERPYVCRECGKLFKKKSHLLVHQRIHNGEKPYACEACQK
FFRNKYQLTAHQRVHTGERPYECNDCGKSFTHSSTFCVHKRIHTGEKPYECSECGKSFAE
SSSFTKHKRVHTGEKPYECSECGKSFAESSSLTKHKRVHTGEKPYKCEKCGKLFNKKSHL
LVHQSSHWRKAI
Download sequence
Identical sequences XP_008968032.1.60992

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]