SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_008975181.1.60992 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_008975181.1.60992
Domain Number 1 Region: 179-416
Classification Level Classification E-value
Superfamily Glycerol-3-phosphate (1)-acyltransferase 0.0000000942
Family Glycerol-3-phosphate (1)-acyltransferase 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_008975181.1.60992
Sequence length 456
Comment PREDICTED: glycerol-3-phosphate acyltransferase 4 isoform X1 [Pan paniscus]; AA=GCF_000258655.2; RF=representative genome; TAX=9597; STAX=9597; NAME=Pan paniscus; AL=Chromosome; RT=Major
Sequence
MFLLLPFDSLIVNLLGISLTVLFTLLLVFIIVPAIFGVSFGIRKLYMKTLLKIFAWATLR
MERGAKEKNHQLYKPYTNGIIAKDPTSLEEEIKEIRRSGSSKALDNTPEFELSDIFYFCR
KGMETIMDDEVTKRFSAEELESWNLLSRTNYNFQYISLRLTVLWGLGVLIRYCFLLPLRI
ALAFTGISLLVVGTTVVGYLPNGRFKEFMSKHVHLMCYRICVRALTAIITYHDRENRPRN
GGICVANHTSPIDVIILASDGYYAMVGQVHGGLMGVIQRAMVKACPHVWFERSEVKDRHL
VAKRLTEHVQDKSKLPILIFPEGTCINNTSVMMFKKGSFEIGATVYPVAIKYDPQFGDAF
WNSSKYGMVTYLLRMMTSWAIVCSVWYLPPMTREADEDAVQFANRVKSAIARQGGLVDLL
WDGGLKREKVKDTFKEEQQKLYSKMIVGNHKDRSRS
Download sequence
Identical sequences A0A2I3GTI6 A0A2J8TNT3 G3RIX8 K7DNJ8 Q5R6J7
XP_001138888.1.37143 XP_003269672.1.23891 XP_003823348.1.60992 XP_004046992.1.27298 XP_008975180.1.60992 XP_008975181.1.60992 XP_009242025.1.23681 XP_016814877.1.37143 XP_018887982.1.27298 ENSGGOP00000015645 ENSPPYP00000020792 9598.ENSPTRP00000034579 ENSPPYP00000020792

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]