SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_008975359.1.60992 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_008975359.1.60992
Domain Number 1 Region: 36-276
Classification Level Classification E-value
Superfamily Caspase-like 2.54e-95
Family Caspase catalytic domain 0.00000000031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_008975359.1.60992
Sequence length 277
Comment PREDICTED: caspase-3 isoform X2 [Pan paniscus]; AA=GCF_000258655.2; RF=representative genome; TAX=9597; STAX=9597; NAME=Pan paniscus; AL=Chromosome; RT=Major
Sequence
MENTENSVDSKSIKNLEPKIIHGSESMDSGISLDNSYKMDYPEMGLCIIINNKNFHKSTG
MTSRSGTDVDAANLRETFRNLKYEVRNKNDLTREEIVELMRDVSKEDHSKRSSFVCVLLS
HGEEGIIFGTNGPVDLKKITNFFRGDRCRSLTGKPKLFIIQACRGTELDCGIETDSGVDD
DMACHKIPVEADFLYAYSTAPGYYSWRNSKDGSWFIQSLCAMLKQYADKLEFMHILTRVN
RKVATEFESFSFDATFHAKKQIPCIVSMLTKELYFYH
Download sequence
Identical sequences P42574
ENSP00000311032 ENSP00000428929 NP_004337.2.87134 NP_004337.2.92137 NP_116786.1.87134 NP_116786.1.92137 XP_003823510.1.60992 XP_008975357.1.60992 XP_008975358.1.60992 XP_008975359.1.60992 XP_011530603.1.92137 XP_014200282.1.60992 XP_014200283.1.60992 9606.ENSP00000311032 gi|14790115|ref|NP_116786.1| gi|14790119|ref|NP_004337.2| ENSP00000311032 ENSP00000311032 ENSP00000428929

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]