SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_008979752.1.60252 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_008979752.1.60252
Domain Number 1 Region: 46-138
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 5.49e-38
Family SCAN domain 0.0000585
Further Details:      
 
Domain Number 2 Region: 642-699
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.69e-27
Family Classic zinc finger, C2H2 0.0041
Further Details:      
 
Domain Number 3 Region: 586-643
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.96e-25
Family Classic zinc finger, C2H2 0.0036
Further Details:      
 
Domain Number 4 Region: 474-531
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.44e-24
Family Classic zinc finger, C2H2 0.0044
Further Details:      
 
Domain Number 5 Region: 530-587
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.22e-23
Family Classic zinc finger, C2H2 0.0035
Further Details:      
 
Domain Number 6 Region: 418-475
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.37e-23
Family Classic zinc finger, C2H2 0.0037
Further Details:      
 
Domain Number 7 Region: 684-736
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.85e-21
Family Classic zinc finger, C2H2 0.0035
Further Details:      
 
Domain Number 8 Region: 380-432
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.2e-19
Family Classic zinc finger, C2H2 0.0048
Further Details:      
 
Domain Number 9 Region: 224-284
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 0.000000222
Family KRAB domain (Kruppel-associated box) 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_008979752.1.60252
Sequence length 753
Comment PREDICTED: zinc finger protein with KRAB and SCAN domains 7 isoform X1 [Callithrix jacchus]; AA=GCF_000004665.1; RF=representative genome; TAX=9483; STAX=9483; NAME=Callithrix jacchus; AL=Chromosome; RT=Major
Sequence
MTTEGRGNVGLILRSTAFQKQEGRLTMKQEPASQTWGQGSSLQKNHPPVCEIFRLHFRRL
CYHEMSGPQEALSRLRELCRWWLMPEVHTKEQILELLVLEQFLSILPGELRTWVQLHHPE
SGEEAVAVVEDFQRHLSGPEEVSAPAQEQEIHLEETTALAATKESPPASPLSGGSDFGAH
LHPPYDPRTHHFANGDFAQPASPVPTLPQVGNSGDQAGATVLRMVRPQDTVAFEDLCVDY
TQKNQKCPALSQRAMHCNVMPDNDHSMASLAGENKLESSELTPKQEIFKGSKSSNRTSGE
LFGVVPGGTETGDVCEDTFKELEGQTSDEERSRLENDFLETDEDKKKFTKDRFNKYKEVG
EHTRLSSSPAENEEILKGQKSYQCDECGKTFHRSSHLIGHHRIHTGEKPYECNDCGKTFR
QTSQLIVHLRTHTGEKPYECSECGKAYRHSSHLVQHQRLHNGEKPYKCNECAKAFTQSSR
LIDHQRIHTGEKPYECNECGEAFIRSKSLVRHQVLHTGKKPYKCNECGRAFCSNRNLIDH
QRTHTGEKPYECSECGKAFSRSKCLIRHQSLHTGEKPYKCSECGKAFNQNSQLVEHERIH
TGEKPFECSECGKAFSLSKCLIRHQRLHTGEKPYKCNECGKSFNQNSHLIIHQRIHTGEK
PYECNECGKVFSYSSSLMVHQRTHTGEKPYKCNDCGKAFSDSSQLIVHQRVHTGEKPYEC
SECGKAFSQRSTFNHHQRTHTGEKPSGLGWSVS
Download sequence
Identical sequences F7GUT1
ENSCJAP00000003238 ENSCJAP00000003238 XP_008979752.1.60252

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]