SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_008982622.1.60252 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_008982622.1.60252
Domain Number 1 Region: 332-424
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 1.28e-24
Family Tudor domain 0.00000326
Further Details:      
 
Domain Number 2 Region: 50-121
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 2.05e-17
Family Eukaryotic type KH-domain (KH-domain type I) 0.0017
Further Details:      
 
Domain Number 3 Region: 122-203
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 2.19e-17
Family Eukaryotic type KH-domain (KH-domain type I) 0.00000757
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_008982622.1.60252
Sequence length 560
Comment PREDICTED: tudor and KH domain-containing protein [Callithrix jacchus]; AA=GCF_000004665.1; RF=representative genome; TAX=9483; STAX=9483; NAME=Callithrix jacchus; AL=Chromosome; RT=Major
Sequence
MSTERTSWTSLSTIQKIALGLGIPASATIAYILYRRYRESREERLTFVGEDDIEIEMRVP
QDAVKLIIGRQGANIKQLRKQTGARIDVDTEDVGDERVLLISGFPVQVCKAKAAIHQILT
ENTPVSEQLSVPQRSVGRIIGRGGETIRSICKASGAKITCDKESEGTLLLSRLIKISGTQ
KEVAAAKHLILEKVSEDEELRKRIAHSAETRVPRKQPISVKREEVTEPGGAGEPALRKNS
SSSMEPAAPLVTPSPKGGGDMAVVVPKEGSWEKHSDDSFQKSGAQAISEMSMFEIPSPDF
SFHADEYLEVYVSASEHPNHFWIQIVGSRSLQLDKLVNEMTQHYENSVPEDLTVYVGDIV
AAPLPTNGSWYRARVLGTLENGNLDLYFVDFGDNGDCPLKDLRALRSDFLSLPFQAIECS
LARIAPSGDQWEEEALDEFDRLTHCADWKPLVAKISSYVQTGISTWPKIYLYDTSNGKKV
DIGLELVRKGYAIELPEDVEENRAAPDMKDMATETDASLSTLLTETKKSSGEITHTLSCL
SLSEAASMSGDDNLEDDYLL
Download sequence
Identical sequences B0KWD5
ENSCJAP00000014787 ENSCJAP00000014807 ENSCJAP00000014811 XP_008982622.1.60252

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]