SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_008986098.1.60252 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_008986098.1.60252
Domain Number 1 Region: 372-429
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.29e-23
Family Classic zinc finger, C2H2 0.0077
Further Details:      
 
Domain Number 2 Region: 428-485
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.6e-23
Family Classic zinc finger, C2H2 0.0055
Further Details:      
 
Domain Number 3 Region: 232-289
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.02e-22
Family Classic zinc finger, C2H2 0.0066
Further Details:      
 
Domain Number 4 Region: 4-61
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 4.18e-22
Family KRAB domain (Kruppel-associated box) 0.0012
Further Details:      
 
Domain Number 5 Region: 485-541
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.2e-22
Family Classic zinc finger, C2H2 0.0047
Further Details:      
 
Domain Number 6 Region: 596-653
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.3e-20
Family Classic zinc finger, C2H2 0.0083
Further Details:      
 
Domain Number 7 Region: 288-345
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.9e-20
Family Classic zinc finger, C2H2 0.0061
Further Details:      
 
Domain Number 8 Region: 540-597
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.95e-20
Family Classic zinc finger, C2H2 0.0073
Further Details:      
 
Domain Number 9 Region: 149-205
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.64e-19
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Domain Number 10 Region: 643-694
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.72e-17
Family Classic zinc finger, C2H2 0.0088
Further Details:      
 
Domain Number 11 Region: 94-150
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000124
Family Classic zinc finger, C2H2 0.0049
Further Details:      
 
Domain Number 12 Region: 195-227
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000356
Family Classic zinc finger, C2H2 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_008986098.1.60252
Sequence length 695
Comment PREDICTED: zinc finger protein 607 isoform X2 [Callithrix jacchus]; AA=GCF_000004665.1; RF=representative genome; TAX=9483; STAX=9483; NAME=Callithrix jacchus; AL=Chromosome; RT=Major
Sequence
MACRSITFRDVAIDFSHQEWEYLNLVQKTLYQEVMMENYDNLVSLGHSISKPDLITLLEQ
GKEPWMIVREETRGECTDLDSRREIINDKKMDIYRKDSSVTLHQRIHNGQKPYECKECQK
AFSHLTELMVHQRIHTSEEHDQREEFGKAFSHLTDLREHQKIHAREKPYKCEECGKVFSY
PSNLAQHGKIHVEKPYECKECGEAFRTSRQLTVHHRFHYGEKPYECKECGKAFSVYGRLS
RHQSIHTGEKPFECNKCGKSFRLKAGLKVHQSIHTGEKPHECKECGKSFRQFSHLVGHKR
IHTGEKPYECKECRKGFTCRYQLTMHQRIYSGEKPYECKENGEAFSSSHQFAAPHTFESI
EKPYKCEECGKAFSVPGRLTRHQGIHSGKKPFECNKCGKSFRLNSSLKIHQNIHTGEKPY
ECKECGKAFSQRAHLAHHNRIHTGYKPFECKECGKSFRCASYLVIHERIHTGEKPYVCQE
CGKGFSYSHKLTMHRRVHTGEKPYECKECGKAFSVSGQLTQHLSVHSGKKPFECNQCGKS
FRFISVLKAHQNVHSAEKPYECKECGKAFRHATSLIYHDRTHAGEKSYECKECGETFSHA
SHLIIHERIHTSDTPYECKRCGKAFRCSSYLVRHERVHADGNPYMCEECGKAFNSSHELS
IHHRVHTGEKPFKCNKCRRSFRLRSILEVHQRIHI
Download sequence
Identical sequences XP_008986098.1.60252 XP_017822731.1.60252

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]